(data stored in ACNUC30630 zone)

EMBL: BX251410.HRDB

BX251410.HRDB        Location/Qualifiers
FT   CDS_pept        296144..297307
FT                   /transl_table=11
FT                   /gene="hrdB"
FT                   /locus_tag="TW263"
FT                   /product="RNA polymerase principal sigma factor hrdb"
FT                   /note="Similar to Streptomyces coelicolor RNA polymerase
FT                   principal sigma factor HrdB or SCO5820 or SC5B8.10
FT                   SWALL:HRDB_STRCO (SWALL:P18183) (511 aa) fasta scores: E():
FT                   2.2e-90, 68.31% id in 385 aa"
FT                   /protein_id="CAD66939.1"
FT                   /translation="MPVKIKTQSRGSDKEAFAGAPSTSGASGAVLDEDLSTDPASHISA
FT                   QATASDTDVASQGSEGDFEAIVLADTKDDESTPASPVISGATADPVKDYLKQIGKVSLL
FT                   TADEEVSLAKRIEAGLFAEEKLSESGDLAPKLKRELRWVVRDGQRAKDHLLAANLRLVV
FT                   SLAKRYTGRGMQFLDLIQEGNLGLIRAVEKFDYVKGFKFSTYATWWIRQAITRAMADQA
FT                   RTIRIPVHMVEVINKLSRVQRQLLQDLGREPTPDELGRELDMPPERVVEVQKYGREPIS
FT                   LHTPLGDEGDSEFGDLIEDVDAVAPDDAVGFSMLQQQLRLLLDSLSEREAGVIRMRFGL
FT                   DYDMPKTLDYVGEYFDVTRERIRQIEAKTMAKLRHPSRSQCLRDYLG"
     atgccggtaa agataaaaac ccagtcgcgc gggtctgata aagaggcttt tgccggggct        60
     ccctctactt cgggtgcttc cggggccgtt cttgacgagg atctttcaac tgatcctgct       120
     tcgcatatct ctgcacaagc cactgcatcc gataccgacg ttgcatctca aggatcggaa       180
     ggggatttcg aggcgatcgt ccttgcggat acaaaggatg atgagtcaac cccggcttcg       240
     cccgtaattt ctggcgccac tgctgaccct gtaaaagatt atttaaagca aatcggtaag       300
     gtatcactcc taacggccga cgaggaggtt agccttgcga agcggatcga ggcgggcctg       360
     tttgccgagg aaaaactctc agagtcaggt gatctcgcgc cgaagctcaa gcgtgagctg       420
     aggtgggttg tgcgcgacgg tcagcgtgcg aaagaccacc ttttagccgc taatttgcga       480
     ttagttgttt ctctggccaa gcggtataca ggccgaggaa tgcagtttct tgacttaatt       540
     caagaaggta atttgggtct cattagggct gttgagaagt ttgactatgt aaagggattt       600
     aagttctcaa cttatgcgac atggtggatt cgtcaggcta tcactcgggc catggccgat       660
     caggcacgga caatccgtat tcccgttcat atggtcgagg ttataaacaa gctttccaga       720
     gtgcaaaggc aacttctaca ggatcttgga cgtgaaccga ctccggatga actgggtcgt       780
     gagcttgaca tgccaccgga gagggtcgtt gaggttcaga aatacgggcg tgaaccgatt       840
     tctcttcaca cccctctcgg cgatgagggt gacagtgagt ttggcgattt gatagaggat       900
     gttgacgctg ttgcgcctga cgatgccgtt gggtttagta tgcttcagca gcaacttcgt       960
     cttcttcttg attctctttc ggagcgtgaa gccggcgtta ttcgtatgcg ctttggactt      1020
     gattatgaca tgcccaagac attggactac gtcggtgagt attttgatgt aactcgggag      1080
     cgcattaggc agattgaggc aaagacgatg gcgaagttac ggcacccatc gcgctctcaa      1140
     tgtttgaggg attatttggg gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page