(data stored in ACNUC30630 zone)

EMBL: BX251410.HUP

BX251410.HUP         Location/Qualifiers
FT   CDS_pept        132298..132579
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="TW128"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="Similar to Escherichia coli DNA-binding protein
FT                   HU-alpha HupA or b4000 or z5576 or ecs4923 SWALL:DBHA_ECOLI
FT                   (SWALL:P02342) (90 aa) fasta scores: E(): 7.7e-08, 37.77%
FT                   id in 90 aa, and to Streptomyces coelicolor, and
FT                   Streptomyces lividans DNA-binding protein HU 1 Hup1 or Hup
FT                   or SCO2950 or SCE59.09 SWALL:DBH1_STRCO (SWALL:O06447) (93
FT                   aa) fasta scores: E(): 5.1e-13, 50.54% id in 91 aa"
FT                   /protein_id="CAD66808.1"
FT                   /translation="MVSLNRTELVAKVAETSGVSRATVNSVIEETFAVFAETVRAGGKV
FT                   TIPGWCSVTRSHRAARTGRNPQTGKTVEIPAGYSVRIAPGSKLKAAVK"
     gtggtttctc tgaatcgcac tgaattggtt gctaaggttg ctgagacgtc tggtgttagc        60
     cgggctactg tgaactctgt tattgaggag acctttgctg ttttcgcgga aacggtacgt       120
     gccggcggta aggtgacgat tcctggctgg tgttctgtta cacgctctca tagagctgcc       180
     cgtactggtc gtaatcccca aaccggtaag accgttgaga ttcctgccgg ttattctgtt       240
     cgtatcgctc ccggcagcaa gttgaaagcc gcagttaagt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page