(data stored in ACNUC30630 zone)

EMBL: BX251410.IDER

BX251410.IDER        Location/Qualifiers
FT   CDS_pept        130688..131341
FT                   /transl_table=11
FT                   /gene="ideR"
FT                   /locus_tag="TW124"
FT                   /product="iron-dependent repressor"
FT                   /note="Similar to Mycobacterium tuberculosis iron-dependent
FT                   repressor IdeR or DtxR or Rv2711 or mt2784 or mtcy05a6.32
FT                   SWALL:IDER_MYCTU (SWALL:Q50495) (230 aa) fasta scores: E():
FT                   6.4e-29, 42.98% id in 221 aa, and to Streptomyces lividans
FT                   and Streptomyces coelicolor iron repressor DesR or DmdR1 or
FT                   SCO4394 or SCD10.26 SWALL:Q54343 (EMBL:Z50049) (230 aa)
FT                   fasta scores: E(): 3.8e-32, 47.23% id in 199 aa"
FT                   /protein_id="CAD66804.1"
FT                   /translation="MYLRTIVNLEEEGISPIIKARISERIGHTAPTVFQTIARMQRDGL
FT                   LVVSSNKSLILTSKGRKIALSVVRKHRLAEVLLHDVVGLEWEHIHLEACRLEHVMSDHL
FT                   EEHLRRILNNPSFTTYGTPIPPADSDFVEPFRDVISLSRAVIRQKARKLSVRCLGEIAQ
FT                   QDTILLSQLSKAGLRPGGLGSFMDSQNGILSWTNSGNKFIISHYIAECIFVNQN"
     atgtacttga ggacaattgt caatctcgaa gaagaaggta ttagtccgat aataaaggcc        60
     aggatttctg agcgtatcgg acacacggcg ccaactgttt ttcagacgat tgcgagaatg       120
     cagcgcgatg ggttacttgt tgtttcgtcg aacaaaagcc tgatccttac atcaaaggga       180
     aggaaaatcg cgctttccgt tgtacgcaaa catcgcctgg cggaggttct tctacatgac       240
     gtggtaggcc ttgaatggga gcatattcat ttggaagctt gtcgccttga acacgttatg       300
     agtgatcacc tcgaagagca cctgcgaaga atattaaata atccatcttt taccacatac       360
     ggaacaccaa ttcctccagc tgatagtgat tttgtagaac catttcgtga tgtgatttct       420
     ctttcacggg ccgttattcg acaaaaagca cgaaaactgt cagtgcggtg tttaggtgaa       480
     attgcgcagc aggacactat tctgctatct cagctttcaa aggccggatt gcgcccgggg       540
     ggattgggaa gttttatgga ttctcagaac ggcattttgt catggacaaa ttcggggaat       600
     aagttcatta tctcgcatta catcgcggag tgcatatttg taaatcaaaa ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page