(data stored in ACNUC30630 zone)

EMBL: BX251410.ISPE

BX251410.ISPE        Location/Qualifiers
FT   CDS_pept        complement(187878..189107)
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="TW159"
FT                   /product="4-diphosphocytidyl-2-c-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="Similar to Escherichia coli
FT                   4-diphosphocytidyl-2-c-methyl-D-erythritol kinase IspE or
FT                   Ipk or b1208 or z1979 or ecs1713 SWALL:ISPE_ECOLI
FT                   (SWALL:P24209) (283 aa) fasta scores: E(): 7.7e-07, 28.95%
FT                   id in 221 aa, and to Streptomyces coelicolor
FT                   4-diphosphocytidyl-2-c-methyl-D-erythritol kinase IspE or
FT                   SCO3148 or SCE66.27c SWALL:ISPE_STRCO (SWALL:Q9K3R6) (299
FT                   aa) fasta scores: E(): 5.9e-21, 39.07% id in 238 aa. Note
FT                   possible alternative translational start sites."
FT                   /db_xref="GOA:Q83IA0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA0"
FT                   /protein_id="CAD66839.1"
FT                   /translation="MKTDGGNTWRASHSKPLNTANTMGEPFSHSEYSVHADQSEFYLNE
FT                   LTEHSGQDNPCMNTSRLNTNRYGHPVVHPCPKIHCICTQSNIAAIGSDCTGCVDIAQAC
FT                   KMLRGGQGCTQDPCVKNPHTQCFTDVSNHAMRNVLPLNVSNTEQFPIQIEYANGRNPVL
FT                   NPMDDLAMRAALLLSKDIDLQNTHILPSTRISIEKNIPVAAGLAGGSADAAAVLLGINS
FT                   AWQTNYSRCDLLGKAGALGADVPFLIWGGAAYGSGTGSCVTFFETQTLYWVLCFSKHPL
FT                   STRKVFQELDRQRSGAGCNHHPVFSNPAECAEMLKKAIKRGPEALAALLHNDLTSAAKM
FT                   LMPEIAERIKAAERCPGILRAIISGSGPTLALLAEDAEAANRACSILKDTGVICKAVSS
FT                   PAYSSIYWQT"
     atgaaaaccg atggtggtaa tacttggcgc gccagccata gcaagccact aaatactgca        60
     aatactatgg gggaaccttt tagtcattct gaatattcag tgcatgcgga tcaatctgaa       120
     ttctatctaa atgaattgac agaacattct ggtcaggata atccctgtat gaacactagc       180
     aggctgaata ctaacagata tggccatcct gttgtgcatc catgtcccaa aatacactgc       240
     atttgcacac agtcaaatat cgctgctatt gggtcagatt gtacggggtg tgtggatatt       300
     gcccaggcgt gcaaaatgct gcgaggtggg caggggtgca cacaagaccc atgcgtaaaa       360
     aaccctcaca cacaatgttt tacggacgtg tcaaaccatg ctatgcgtaa tgttttaccg       420
     ctgaatgtat caaatacaga gcaattcccg atacaaatag aatacgcaaa cggccgaaat       480
     cccgtcttga atccaatgga tgatctcgcg atgcgtgcag cccttttact atctaaggat       540
     atagatcttc aaaatacaca tattttaccc agtacgcgta tttcgattga gaagaatatt       600
     ccggttgccg ctggtctggc ggggggttca gctgacgctg cagcggtctt gcttgggata       660
     aacagtgcat ggcaaacaaa ttattctaga tgtgatttgc taggaaaggc aggtgcactc       720
     ggtgcagatg tacccttttt aatctggggt ggggctgcct atggaagcgg aaccggttca       780
     tgtgtgactt tttttgaaac acaaactctg tactgggttt tatgcttttc aaagcatcct       840
     ctatccactc gcaaggtatt tcaagagctc gatcgacagc gcagtggtgc cggatgcaat       900
     catcaccctg ttttttccaa cccagcagag tgtgcagaaa tgctaaaaaa ggcaataaaa       960
     agagggccag aagcgctagc agctcttttg cataatgatc ttacaagcgc cgcaaagatg      1020
     cttatgccag aaattgcaga gcggatcaaa gcagcagaaa gatgccctgg gattctgcga      1080
     gcaatcataa gcggatccgg accgaccctt gccctgttgg cagaagacgc agaggcggct      1140
     aatagggcat gcagtatcct gaaagacacg ggtgttatct gcaaagcagt atcatctccg      1200
     gcgtattcga gtatatactg gcagacgtaa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page