(data stored in ACNUC30630 zone)

EMBL: BX251410.LSPA

BX251410.LSPA        Location/Qualifiers
FT   CDS_pept        277872..278324
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="TW250"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="Similar to Staphylococcus aureus lipoprotein signal
FT                   peptidase LspA or Lsp SWALL:LSPA_STAAU (SWALL:P31024) (163
FT                   aa) fasta scores: E(): 1.9e-07, 35.82% id in 134 aa, and to
FT                   Bacillus halodurans lipoprotein signal peptidase LspA or
FT                   Lsp or bh2543 SWALL:LSPA_BACHD (SWALL:Q9K9V2) (156 aa)
FT                   fasta scores: E(): 3.5e-09, 36.48% id in 148 aa"
FT                   /db_xref="GOA:Q83I41"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I41"
FT                   /protein_id="CAD66926.1"
FT                   /translation="MTTRTLRFYALVGFLVFLDQVTKYLAHAYLARDFIVIPNLFRLTL
FT                   AKNSGAAFSFGTGFSWLFFLLGIIALIFIGWFLPRTTGSIVFLALLQGGIAGNVFDRLF
FT                   KPPYFGNGEVVDFLNTPLFSGVVFNIADLFILAGVFGTFLFLKGSK"
     ttgacgacta gaaccctgcg gttctacgct ctggtgggtt ttttagtttt tctggatcag        60
     gttaccaagt atcttgcgca tgcttatctt gcgcgcgatt ttattgttat tccgaatctt       120
     tttaggctta ctcttgcgaa gaattcgggt gctgccttct cttttggaac tggcttttct       180
     tggcttttct ttttgctcgg gattattgcc cttattttta ttggatggtt tttaccgagg       240
     acaactggat cgatagtatt tttggccctg ttacagggag gtattgctgg caatgtgttt       300
     gataggcttt tcaagcctcc atattttggt aatggcgagg tggtggattt tctaaacacc       360
     ccattgttct ctggagttgt gtttaacatt gccgatcttt tcatattggc tggagtcttt       420
     gggacgttct tgtttttgaa ggggtcaaag taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page