(data stored in ACNUC30630 zone)

EMBL: BX251410.LYSS

BX251410.LYSS        Location/Qualifiers
FT   CDS_pept        complement(62943..64580)
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="TW072"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Similar to Pyrococcus horikoshii lysyl-tRNA
FT                   synthetase LysS or ph0224 SWALL:SYK_PYRHO (SWALL:O57963)
FT                   (523 aa) fasta scores: E(): 2e-56, 33.2% id in 530 aa"
FT                   /protein_id="CAD66759.1"
FT                   /translation="MTASRIDAASPEKYGKQDWVSKLAEQVIQERKGDKKIVVASGISP
FT                   SGQIHLGNLREVITGHFIADEISSRGFDCEHILSWDDFDRLRKVPANIDKGYEQYIGMP
FT                   LCDVPPPAGSKKNSWSEHFRGDFEKTMEILGIKVRHISQSQMYRSGAYTHNILLALEKR
FT                   HEIQNIIGKYQSKKTQPAESPREYYPYVVYCTRCKKDLTQIEDFAGSELSYSCKCGHSE
FT                   TIGIGEFNNGKLPWKVDWPMRWMYESVDFEPGGVDHCSPGSASLSASSDIANQIFNWTP
FT                   PLTVMYSFVGVQGHAKMSSSTGNVLTPNDALSVMEPTLLRWMYARRKPNQSFTVGFDQS
FT                   LQRLYDEWDSLPNDLTGCELASSYTRAMSTTNKRFNAPEILISFRTLVSLIDISASDDS
FT                   QLLRMVKNLRPDIRSLAQLEPRLSCARIYSKKFSNPIHVLQTPNKQVLHTAAPNVREML
FT                   RIFIDGLDKNWSIEKLTTLAYGVPKVVLGIDQSSKDVSQEVKNLQKEFFRTIYQLVIGQ
FT                   DKGPRLPTLLMAIGKQSTRALLCSCETC"
     atgacggcat caagaattga cgctgcaagt cccgaaaaat atggaaagca agactgggtt        60
     tcaaaacttg ccgagcaggt tatacaagag cgtaaagggg ataaaaaaat tgttgtagcg       120
     tctggaatca gcccatcagg gcaaatccat ttgggtaacc tcagggaggt gataaccgga       180
     cattttattg ccgacgaaat aagctcgagg ggttttgatt gcgaacacat actgtcttgg       240
     gatgacttcg atcgtctgag aaaagtacca gcaaatatcg acaaaggcta cgaacaatat       300
     atcgggatgc cactgtgtga tgtcccgcct ccggcaggaa gcaaaaaaaa cagctggtcg       360
     gagcattttc ggggagattt tgagaaaaca atggaaattc tcggaataaa ggtaaggcat       420
     ataagccaga gtcaaatgta tcgttcgggt gcgtatacac acaatattct gctcgcgctc       480
     gaaaagcggc atgagattca gaacataatt ggcaaatacc agagcaagaa gacccaacct       540
     gccgagtcac ctcgagagta ttacccctat gttgtatatt gcacacgttg taaaaaagat       600
     ctgacacaaa tagaggattt tgcggggagt gagctctcat attcttgcaa atgcgggcat       660
     tctgaaacca ttggcatagg ggaattcaac aacggaaaac ttccctggaa agttgactgg       720
     cctatgcggt ggatgtacga atcagttgat ttcgaacctg gaggtgttga tcactgttcg       780
     ccaggatcgg catcgctatc agccagtagt gatattgcaa atcaaatatt taattggacc       840
     cctcctttga ccgtaatgta ctccttcgtt ggagttcagg ggcacgcaaa aatgtctagc       900
     tcaacgggta atgttctaac ccccaatgat gcgctatcgg ttatggagcc aacccttctg       960
     cggtggatgt atgcccgcag aaaacccaac caatcattca cggtcgggtt tgaccagagc      1020
     ctacaaagac tatatgacga atgggacagt ctaccgaatg atcttacggg gtgtgaattg      1080
     gcatcctctt atacccgcgc aatgtcaaca accaataaaa gattcaatgc accggagatt      1140
     ctcatttctt tcagaacact ggtttcgctg atcgacatat cggcaagtga tgattcccaa      1200
     ctgctaagga tggtgaaaaa cttacgccct gatattaggt cccttgcgca actcgagcca      1260
     agattgagct gcgcaaggat ctatagtaaa aaattctcaa acccaataca tgttctgcaa      1320
     actccaaaca agcaagtttt gcataccgca gcgcccaatg tgagggaaat gctgcgcatc      1380
     ttcattgatg gcttagataa gaattggtct atcgagaagc ttacgacact cgcctacgga      1440
     gtgcccaaag tcgtcttggg tatagatcag tcctcaaaag acgtaagtca agaggtaaaa      1500
     aatttacaga aagagttctt taggacgata taccagttgg ttataggtca ggacaagggt      1560
     ccgaggcttc caaccttact gatggcaata ggaaaacaga gtacacgagc actgctttgc      1620
     agctgtgaga catgctag                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page