(data stored in ACNUC30630 zone)

EMBL: BX251410.MANB

BX251410.MANB        Location/Qualifiers
FT   CDS_pept        146782..148212
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="TW137"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Similar to Escherichia coli phosphomannomutase ManB
FT                   or RfbK or RfbK2 SWALL:RFK9_ECOLI (SWALL:P37755) (456 aa)
FT                   fasta scores: E(): 4.3e-48, 34.44% id in 450 aa, and to
FT                   Streptomyces coelicolor phosphomannomutase ManB or SCO3028
FT                   or SCE34.09c SWALL:Q9KZL6 (EMBL:AL353862) (454 aa) fasta
FT                   scores: E(): 6.8e-88, 51.96% id in 458 aa"
FT                   /protein_id="CAD66817.1"
FT                   /translation="MPQRGGLCSSIHSYSGRSVSVFKAYDVRGLVPEQLTTDISRAIGA
FT                   AYIDSLGCSSIVVGRDMRPSSKELFYAFAEGCTARGASVIDIGLCSTDAVYYASGAWNI
FT                   PAAVFTASHNPPEYNGIKFCRPGAQGIGYTTGLSDVEKISDKYLLKGIPHAETKGKVVK
FT                   KSVGREYAEYICNLVGPLQKPLKVVIDAGNGMAGKMVPIVMQSALTDIEILPLYFELDG
FT                   TFPNHEANPFDPKNLVDLQHAVKETGADIGLAFDGDADRCVVIDEMSNPVTPSSIASIV
FT                   VGRILKQYGNAKATIVHNLLVSRGFAESVISRNSENRLVRTRVGHSFIKDIMHKTNALF
FT                   GCEHSAHYYFRDFWGADNGMLAALYVMAELCESPMPMSVLSRKYTPYFQSGETNYRVHN
FT                   PDMTMSAIRQAFPGAYVEFLDGMTLYESVKDPGPERFWWLNVRKSNTEPLLRLNVEAQT
FT                   EDLMRLVRDKAVKIITGG"
     atgccccaaa ggggtggact ttgttcaagc attcactcgt attcagggcg tagtgtgtct        60
     gtttttaagg catatgacgt gcgtggcctt gtgccggagc agcttacaac tgacataagc       120
     cgcgcaattg gtgcggctta tattgatagt ctcggatgct catctatcgt ggttggcaga       180
     gatatgcgcc cgtcttctaa agagctattt tacgcatttg ccgaaggatg cactgcgcgc       240
     ggtgcatctg tgatagacat aggcctatgt tcaacagacg ccgtctatta tgcatcaggt       300
     gcctggaata tcccagctgc agtattcacc gcaagccata atccgccaga gtataacgga       360
     ataaagtttt gtcgccccgg tgcgcagggc atcgggtata caactgggtt aagtgatgtt       420
     gagaaaatat cggataaata ccttctaaag ggaatcccac acgcagagac aaaaggtaaa       480
     gttgtcaaaa agagtgtggg gcgtgaatat gcggagtata tctgtaacct cgtaggccct       540
     ctgcaaaaac ctttaaaagt tgttatagac gccgggaatg ggatggccgg caagatggta       600
     cccatagtta tgcagtccgc tttgaccgat attgaaatcc ttccgcttta ttttgaactt       660
     gatggcactt tcccaaacca tgaggcgaat ccatttgatc caaaaaatct tgtggatctc       720
     cagcatgcag taaaagaaac tggagcagat attggtcttg cgtttgatgg tgatgctgat       780
     cgctgtgtcg ttattgatga aatgtcaaac cctgttaccc catcttctat cgcgagtatt       840
     gttgtgggaa gaattcttaa acagtacggc aacgcgaagg ctaccatagt gcataatctg       900
     cttgtttcta ggggttttgc agagagtgtt atatcaagaa acagcgagaa tagacttgtc       960
     cgtacacgag ttggtcactc atttataaaa gatattatgc ataaaacaaa tgcgctgttt      1020
     ggatgtgagc attctgcaca ttattatttc cgtgatttct ggggtgcgga taacggcatg      1080
     cttgcggcat tgtacgtaat ggccgaactg tgtgagtcac ccatgccaat gtctgtattg      1140
     tccaggaagt acaccccgta ctttcagtcc ggcgaaacaa attaccgtgt acataaccca      1200
     gatatgacaa tgtctgcgat acgacaggcc tttccgggtg cttatgtaga gtttttggat      1260
     ggcatgacgc tatatgaatc agttaaagac cctggaccag agaggttttg gtggttgaat      1320
     gtcaggaagt ctaatacaga gcccttactc cgccttaatg ttgaggctca gacagaggac      1380
     ctaatgagac tggttcgcga taaagcagta aagataatca ccggtggatg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page