(data stored in ACNUC30630 zone)

EMBL: BX251410.MENA

BX251410.MENA        Location/Qualifiers
FT   CDS_pept        72796..73707
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="TW080"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Similar to Escherichia coli
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA or
FT                   b3930 SWALL:MENA_ECOLI (SWALL:P32166) (308 aa) fasta
FT                   scores: E(): 8.9e-17, 33.45% id in 275 aa, and to
FT                   Mycobacterium tuberculosis probable
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA or
FT                   Rv0534c or mt0558 or mtcy25d10.13C SWALL:MENA_MYCTU
FT                   (SWALL:O06400) (292 aa) fasta scores: E(): 2.8e-24, 40.63%
FT                   id in 251 aa"
FT                   /protein_id="CAD66765.1"
FT                   /translation="MALEKRRRKKKRSLILPWLLASRPATLIVSLSAVSLGWGAALLTV
FT                   TGRKASLLLVALAALTAVLLQIGANYINDYGDGIRGADSNRSHASRRLTASGANPFSVL
FT                   TTGLSFLIAAAGSGLIAVILTQRWQLILVGVFSIAAAYLYTAGPFPYAYFGLGELSVFI
FT                   FFGPVTVIGTVFLLSGIVTLSSFLVAVVAGSWSAAILLMNNLRDHESDMQSNKRTFSVL
FT                   FGVLIARIVCIALIAVPYIVVAILLIELPFIGYVFLTLLLSAPIVIILATAVTSKEFAI
FT                   AFRLGIICLIPFAIFFTWGLAS"
     gtggccttgg agaaacgcag aagaaaaaag aaaagaagct tgatactgcc gtggctactt        60
     gcttcccgcc cggccaccct cattgtttcc ctgtcggcag tttcgcttgg gtggggtgct       120
     gcacttctga ccgtcaccgg aagaaaggct tcacttttat tagttgctct tgcggcattg       180
     accgctgttt tactccagat tggtgcgaat tacatcaacg actatgggga tggaatacgc       240
     ggcgcagatt ccaataggtc gcacgcctcg cggcgcctta cagcctcagg cgctaatccg       300
     ttttcggttc tgacgactgg tctttcattt ttgattgccg ctgcaggctc tggactgatt       360
     gccgttatcc tcacccagag gtggcagctc atcttagtcg gtgtgttttc gattgctgct       420
     gcttacctgt acactgcagg acctttcccg tacgcttatt tcggacttgg ggaattgtct       480
     gtttttattt ttttcggacc cgtaacagtt atcgggactg tctttctgtt gtctggaatt       540
     gttacactgt catcttttct ggtagctgtt gttgcaggtt catggtctgc cgccattctg       600
     cttatgaata atttgcgtga tcacgaaagt gatatgcaga gcaataaacg taccttctcc       660
     gttttgtttg gggtcttaat tgccaggata gtttgcattg ctctgattgc tgtgccctac       720
     attgtagtcg cgattctgtt aatcgagttg ccttttattg gctatgtttt tttaaccctt       780
     ctcctcagcg cgccaattgt gataattttg gccactgccg tgacttcaaa agagtttgca       840
     atagctttta ggcttgggat catttgtctg attccatttg caatattttt tacttgggga       900
     cttgctagct ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page