(data stored in ACNUC30630 zone)

EMBL: BX251410.MENB

BX251410.MENB        Location/Qualifiers
FT   CDS_pept        128106..129023
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="TW120"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="Similar to Escherichia coli naphthoate synthase MenB
FT                   or b2262 SWALL:MENB_ECOLI (SWALL:P27290) (285 aa) fasta
FT                   scores: E(): 1.3e-46, 48.76% id in 283 aa, and to
FT                   Mycobacterium tuberculosis MenB or Rv0548c or mtcy25d10.27c
FT                   or mt0573 SWALL:O06414 (EMBL:Z95558) (314 aa) fasta scores:
FT                   E(): 4.5e-71, 63.39% id in 295 aa"
FT                   /protein_id="CAD66802.1"
FT                   /translation="MGESKGAPTFDTLQHVLLSELFDPDLWVAHEGFEACDVTYHTAPG
FT                   VARIAFNRPEIRNAFRPETVDQLYAALDHARVSDKIGAVLLTGNGPSPRDGIRAFCAGG
FT                   DQKTRRRDGYAYSDSHRSSRMHILEVQRLIRFMPKPVIALVNGWAAGGGHSLHVVCDLS
FT                   IASLEHAKFKQTDATVASFDSGFGSAYFARQVGQKFAREVCFLAAEYDAKTALEKGAVN
FT                   AVVAHEYLEQTGYEWARRILEQSPTSIRMFKYALNAVDDGLVGQQIFAGEATRLAYATD
FT                   ESKEGRDAFLEKRRPDWSSFPWSF"
     gtgggtgaat ctaaaggtgc tcccaccttt gatacactcc aacatgtgtt gcttagtgag        60
     ctgtttgacc cggacctttg ggtggcgcat gagggcttcg aagcttgtga tgtaacgtat       120
     cacacagctc ctggggttgc acgtattgca tttaacagac cagagattag aaatgcgttt       180
     cgacccgaaa ctgttgatca gctttatgct gcgctagatc atgcacgggt cagcgataaa       240
     atcggtgctg ttttactgac aggcaatggc ccatccccgc gcgacggtat ccgtgctttt       300
     tgtgcagggg gcgatcagaa aacacgccgg agggatggat acgcatacag cgattcccac       360
     cgttcttcga ggatgcatat tcttgaagtc caaagactga ttcgctttat gccaaagcct       420
     gttattgcat tggtaaacgg gtgggctgcg ggtggtggac attccttgca cgttgtgtgc       480
     gatctcagta ttgcaagcct tgagcatgcc aaattcaagc aaacagacgc aactgtagca       540
     agttttgact caggttttgg aagcgcctat ttcgcccgac aggtcgggca gaagtttgca       600
     cgcgaggtct gttttcttgc ggcagaatat gacgctaaaa ccgctctcga aaaaggtgcg       660
     gttaatgctg tggttgcgca tgagtatctt gagcagaccg gatacgaatg ggcccggagg       720
     attcttgagc agtcaccgac ttcgatacgt atgtttaaat acgcgctaaa tgccgttgat       780
     gatggcctgg tcggacagca gatttttgca ggcgaggcca cacgccttgc gtatgcaaca       840
     gatgagtcaa aagaagggcg tgacgcattc ctcgaaaaac gtcggccaga ctggtcaagc       900
     tttccctgga gcttctag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page