(data stored in ACNUC30630 zone)

EMBL: BX251410.MENE

BX251410.MENE        Location/Qualifiers
FT   CDS_pept        129025..130161
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="TW121"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="Similar to Escherichia coli O-succinylbenzoic
FT                   acid--CoA ligase MenE or b2260 SWALL:MENE_ECOLI
FT                   (SWALL:P37353) (451 aa) fasta scores: E(): 2.5e-10, 28.11%
FT                   id in 345 aa, and to Mycobacterium tuberculosis MenE or
FT                   Rv0542c or mtcy25d10.21c or mt0567 SWALL:O06408
FT                   (EMBL:Z95558) (362 aa) fasta scores: E(): 2.5e-29, 32.84%
FT                   id in 338 aa"
FT                   /protein_id="CAD66803.1"
FT                   /translation="MTKALMRGQITLDSVKRVLEDERFAICASEEPLSCGGKIMVDDAV
FT                   CLVINTSGSTASPKRVAFSSSSLMNSARACCSVLGYGQWVLCLPKQYTAGVRVLVRSIL
FT                   SGTKPIDISEDRFSPENFIHACRRLSCSNTFTALVPTQLSALVRVAEDDKNVAKVLSGF
FT                   TGVIVGGQHIARSLLERSRLLGINLFTSYGLTETFGGCVYNGLPLPGVQIQIIDGRAAI
FT                   ASPSLALGYLKENGQIDETGFFFDRGERWFHTNDLAVMNRGKLIIHGRIDRVINSGGMK
FT                   LDLNAIETALRSLDCVEDAVLLGVKSKKWGQHFCAFIDIGDVTKADRTDCLQKINTLLS
FT                   TFGRACRSGQIKLIHPIPRTFSGKPDRIALQRGLQNNI"
     atgaccaagg ctctcatgcg ggggcaaatt acacttgact ctgtaaaaag agtccttgag        60
     gacgagcgat ttgctatttg tgcgtcagaa gagcctctct catgcggggg caaaataatg       120
     gtcgacgatg cggtttgtct cgtaataaat acatctggat caaccgcctc gcccaagaga       180
     gttgcgtttt catcatcatc tcttatgaac tctgctcgtg cgtgctgctc cgttcttggc       240
     tatggacagt gggttttgtg cttaccaaag caatatactg ccggggtgcg tgtgcttgta       300
     cgatccattc tgtctggcac gaaaccaata gatatttctg aggatagatt ttcccctgaa       360
     aatttcatac atgcatgccg gaggttatct tgctcgaata cctttactgc acttgtccca       420
     acccagctca gtgcccttgt tagggtggca gaggatgaca aaaacgttgc aaaagttttg       480
     agtggcttta cgggcgttat tgtcggaggg cagcatattg cgcgatcact gcttgaaaga       540
     agcaggttgc tcgggatcaa tttatttact tcatacgggt tgaccgaaac ttttggtgga       600
     tgcgtttaca atggccttcc tcttcctgga gtgcagatac agattattga cggaagggcc       660
     gcaatcgcct cccccagtct ggcgcttggg tatctaaaag aaaacgggca aatcgatgaa       720
     acaggatttt tttttgaccg aggtgagcgg tggtttcaca caaatgatct tgccgttatg       780
     aatcggggaa aattgataat ccacggccgg atcgacagag ttataaacag tggagggatg       840
     aagcttgacc taaacgctat cgaaacagct cttagatctc ttgactgcgt tgaggatgct       900
     gttttgctgg gtgttaagtc gaaaaaatgg ggtcagcact tctgtgcgtt tatcgatatt       960
     ggtgatgtca caaaggccga taggactgat tgcctgcaaa aaataaacac cctcctttca      1020
     acctttggcc gcgcgtgccg atctggacag ataaagctta ttcatccaat accccgcact      1080
     tttagcggta aaccagatcg aattgcccta caaagaggat tacagaacaa tatttga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page