(data stored in ACNUC30630 zone)

EMBL: BX251410.MURA

BX251410.MURA        Location/Qualifiers
FT   CDS_pept        283980..285305
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="TW254"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="Similar to Bacillus subtilis UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase 1 MurAa or MurA SWALL:MUA1_BACSU
FT                   (SWALL:P70965) (436 aa) fasta scores: E(): 3.9e-41, 35.94%
FT                   id in 434 aa, and to Streptomyces coelicolor
FT                   UDP-N-acetylglucosamine transferase MurA or SCO2949 or
FT                   SCE59.08 SWALL:Q9L1U5 (EMBL:AL138851) (448 aa) fasta
FT                   scores: E(): 5e-102, 58.73% id in 441 aa"
FT                   /protein_id="CAD66930.1"
FT                   /translation="MKLDSTPDRFVITGGSPLRGEIAVKGAKNLVTKAMVASMLGNSQS
FT                   VLTNVPNISDVLIVRRLMEAYNVSVRATQNDTLVIDPILLGQCSRGDIDVYAGSSRVPI
FT                   LFCGPLLHKTGQAFITGLGGCRIGERPIDFHLQALRKFGASHEKLPGGILLSTKKRLKG
FT                   ASVHFPYPSVGATEQVLLTAVLADGVTELRGAAIEPEIMDLIAILQKMGAIITCARDRV
FT                   IFIEGVDSLSGYTHHAISDRNEAASWACAALATRGDIFVRNAEQAHLLAFLSVYRKVGG
FT                   VFEIKDDGIRFFHPGGNLNPVVVETDVHPGFSTDWQQPLVVALTQASGRSVVHETVYES
FT                   RFGFTEALNRMGADISVHENGFQGTLRRVPHRAIEQAAVINGPTPLTGQDIDVPDLRGG
FT                   FSHFIAAFAAEGKSIITNAGIISRGYENFVHKLERLKVDFEA"
     atgaagcttg atagcacccc tgacaggttt gttataacgg gcggctcgcc gttacgtggt        60
     gaaattgctg ttaagggtgc taaaaacctt gtaacgaagg caatggtcgc ctcaatgctc       120
     ggcaattcac agagcgtctt gacaaatgtg cccaatatat cggatgtcct tattgtccgg       180
     agacttatgg aggcttataa cgtaagtgta cgtgccacgc agaacgacac actcgttatt       240
     gatccgattc ttcttggaca gtgctctcgg ggtgatattg atgtttatgc cggatccagc       300
     agagttccaa tcttgttttg cggtccgcta cttcataaaa caggacaggc atttattact       360
     ggcttgggcg gttgcaggat tggggaacga ccaattgatt ttcatttaca agccctgagg       420
     aagtttggcg caagtcatga aaaacttcca ggtggaatac ttctttcaac aaaaaaaaga       480
     ttgaaaggtg cgagtgtaca ctttccgtat ccaagtgttg gtgccacgga acaggttctg       540
     ctgacggctg ttttagcaga tggtgttaca gagcttagag gtgccgcaat tgagccggaa       600
     ataatggatc tgatcgcgat attgcagaaa atgggtgcga tcattacctg cgcacgagac       660
     agggtaattt ttatagaggg tgtcgacagt ttatcaggct atacacacca cgctatcagt       720
     gaccgcaatg aagccgccag ttgggcctgt gctgcacttg caacgcgagg tgatatcttc       780
     gtgcggaacg ccgaacaggc acatcttctc gcatttctta gtgtatacag gaaggttggt       840
     ggagtgtttg agatcaaaga tgatggaata aggttttttc atcccggtgg taacctgaat       900
     cccgttgttg ttgaaacaga tgttcatccg ggcttctcaa cagactggca gcagcccctc       960
     gttgttgccc tgacacaggc gagcggcaga tccgtcgtgc acgagactgt ctatgaatct      1020
     cgctttggat tcactgaagc tctcaacaga atgggtgcag atatttctgt gcacgagaat      1080
     ggttttcagg gaacacttcg cagggtgcca cacagagcca tagagcaagc tgctgtgata      1140
     aatggcccaa ctccattgac cgggcaagac atagatgttc cagatctgag aggtggattc      1200
     agtcatttta ttgctgcatt tgctgcagaa ggaaagagca tcataaccaa tgcgggtatt      1260
     ataagtcgag ggtatgagaa ctttgtccat aagcttgaaa gattgaaagt tgattttgag      1320
     gcatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page