(data stored in ACNUC30630 zone)

EMBL: BX251410.PANC

BX251410.PANC        Location/Qualifiers
FT   CDS_pept        64669..65535
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="TW073"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   pantoate--beta-alanine ligase PanC or cgl0113
FT                   SWALL:PANC_CORGL (SWALL:Q9X713) (279 aa) fasta scores: E():
FT                   1.5e-27, 39.59% id in 293 aa"
FT                   /db_xref="GOA:Q83ID9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83ID9"
FT                   /protein_id="CAD66760.1"
FT                   /translation="MNLKLASSPHELRTCLAGRAFVLVPTMGALHEGHIWLVDMARRCN
FT                   LPVVVSIFVNPLQFDDSLDLDTYPRTLEQDLEKLEGKAFAVYSPSVETMYPNGLDSIRI
FT                   DPGPIGRILEGAIRPGFFDGILTIVAKLLLQTAPERVFFSKKDAQQAFLVRRMVRELAF
FT                   PVRVEVTGFLRDKFSLPYSSRNRKLGVDAREKAQRLSQGLLSVVNNGPLTVRDCIDKIT
FT                   DLANSIGVDLGYAQILDENFCEIASDRMVTRAFHSEACIGLNTPLFLLAARVHGVRVVD
FT                   NVDLVVV"
     atgaatctca aattggcttc ttctccgcat gagctacgga catgcttggc cggcagggca        60
     tttgtgctgg tccccaccat gggggctttg catgagggac atatctggct tgtggacatg       120
     gcaaggcgat gcaatctccc tgttgttgta tcgatttttg tgaaccccct acaattcgat       180
     gacagtcttg atttggatac ttatcccagg actctggaac aggatttaga aaagttagag       240
     ggcaaggctt ttgcagttta ttcgcctagc gtcgaaacaa tgtatccaaa cggtctcgac       300
     tctatccgta ttgacccagg gccaatagga agaattctag aaggcgccat tcgtccgggg       360
     ttctttgatg ggattctcac aattgttgca aaattattgc tacaaaccgc acctgaacga       420
     gtttttttta gcaaaaaaga tgcccaacag gcctttttag tgaggcgcat ggtgcgtgaa       480
     ctcgcctttc ctgtcagggt tgaagttaca ggatttctac gtgataaatt ttccctgcct       540
     tattcctcac gtaatcgtaa gttaggggta gatgcgagag aaaaggctca aagattatcc       600
     caaggattac tctctgttgt aaataatggt ccgcttactg tgcgggattg tatcgacaaa       660
     ataacagatc tagcaaattc aattggtgtc gatttgggct atgcgcagat tctggatgaa       720
     aatttttgcg aaattgcttc ggatagaatg gttacgcggg cattccactc ggaggcctgt       780
     attgggctca ataccccact ttttctgctt gctgcccgtg tacacggggt tcgggtagtc       840
     gacaatgttg atctcgtagt tgtttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page