(data stored in ACNUC30630 zone)

EMBL: BX251410.PCCB

BX251410.PCCB        Location/Qualifiers
FT   CDS_pept        complement(24099..25676)
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="TW025"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /note="Similar to Saccharopolyspora erythraea propionyl-CoA
FT                   carboxylase beta chain PccB SWALL:PCCB_SACER (SWALL:P53003)
FT                   (546 aa) fasta scores: E(): 8.9e-123, 62.5% id in 520 aa"
FT                   /protein_id="CAD66717.1"
FT                   /translation="MTDNFDESSRGLEKYRQAYEVAVTLREDSAKEKQHSKGKMTARER
FT                   IDKLLDENSFTEIDQFAMHSASGFGIEKNHPYGDSVVTGFGSIDGRKVAVYSQDFTVFG
FT                   GSLGEVAGRKIVKTMDLAMSAGIPVIGLLDSGGARIQEGIAALTKYGEIFKRNVAASGI
FT                   IPQISIVMGPAAGGACYSPALTDFVIMVDQISYMFITGPDVIKAVTGEEVTFEDLGGAN
FT                   MHNATSGVSHYMAHSEDDAIAYARELIGFLPSNNMSDPPTWPQDIHTEESDLELNSIVP
FT                   ENPNKPYDMQFVIERIVDDGNFLEIQSAYAKNVIIGFARISGFSIGIVANQPAHMAGAL
FT                   DINASEKAARFVRFCDAFSIPILTLVDVPGYLPGTEQEWTGIIRRGAKLLYAYSEATVP
FT                   MVTIILRKAYGGAYIVMGSKALGADINLAWPSAEIAVMGAQGAVNILYRNDIKRLVQAG
FT                   EDANPMKEKLVKEYTDKFANPFIAAQRGYLDAIIEPAQTRIAIATAFQTIRTKRYKQID
FT                   RKHGSIPL"
     atgaccgata attttgacga atccagtagg gggctagaga agtacaggca ggcatacgaa        60
     gtagcagtca ctttgcgtga ggattctgcg aaggaaaaac aacactcaaa agggaagatg       120
     accgcccggg agcgtataga taaactgctt gacgaaaact cgtttactga aatagaccag       180
     tttgccatgc acagcgcaag tggatttggt atcgaaaaaa accaccctta tggcgactct       240
     gtcgtcacag gttttggctc aatagacggc aggaaagttg cggtatattc tcaggatttc       300
     acggttttcg gtgggtcact cggagaagtg gccggcagga aaatagtaaa aactatggac       360
     ctggcaatgt ctgcaggaat acccgtaata ggtctccttg attccggtgg agccaggata       420
     caggagggaa ttgcggcgct tactaaatac ggagaaatat tcaagcgaaa tgttgcggcg       480
     agcggaatta ttccacaaat ctcaatagtt atggggcctg cggcaggtgg ggcatgctac       540
     tcaccggcac ttacagattt tgtaattatg gtggaccaga tcagctatat gttcatcacg       600
     ggacctgatg ttataaaagc agttacagga gaagaggtga cttttgagga tcttggtggt       660
     gccaatatgc ataacgccac ctctggcgtc tcgcactata tggctcatag cgaagatgac       720
     gcaattgcat acgcccggga gctgattggg tttctgccca gtaataacat gtcagaccct       780
     cccacatggc cacaggatat tcatacggag gagagtgacc ttgaactaaa ttcaattgtg       840
     cccgagaatc caaataagcc ttatgatatg cagtttgtca tagagcgaat tgttgatgat       900
     ggcaattttc tggaaattca atccgcatac gcaaagaatg tcatcatcgg ttttgcgcga       960
     atatcaggct tttcgatcgg tattgttgcg aatcagcctg cgcatatggc aggggctttg      1020
     gatataaatg caagtgagaa agctgcacgg tttgttcgct tttgtgacgc tttttcaatt      1080
     cctattctga cactggttga tgtgccggga tatttacccg ggacagagca ggaatggaca      1140
     ggtattatca ggcgcggtgc gaagcttctc tatgcttatt ccgaggcaac tgtaccgatg      1200
     gtgacaatta tcctgcgtaa agcgtatggc ggggcctata tagtaatggg ctcaaaagcg      1260
     ttaggtgccg atataaacct tgcatggcca tcagcagaaa ttgccgtcat gggcgcccag      1320
     ggtgctgtga atattctcta tagaaatgat ataaagcggc tcgtgcaagc cggtgaagac      1380
     gcaaatccaa tgaaagagaa attggtcaaa gagtacaccg ataaatttgc caatcctttt      1440
     attgccgccc agagaggata tctggatgcg attatagagc cagcacaaac gcgaattgcg      1500
     attgctacag cctttcaaac catcagaacg aagcgttaca aacaaataga cagaaagcac      1560
     ggaagcatac cactgtaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page