(data stored in ACNUC30630 zone)

EMBL: BX251410.PE10

BX251410.PE10        Location/Qualifiers
FT   CDS_pept        complement(11133..11342)
FT                   /transl_table=11
FT                   /locus_tag="TW010"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3854 or SCH69.24 SWALL:Q9XA10 (EMBL:AL079308)
FT                   (84 aa) fasta scores: E(): 1.4e-08, 40% id in 55 aa, and to
FT                   Corynebacterium glutamicum hypothetical membrane protein
FT                   Cgl0040 cgl0040 SWALL:BAB97433 (EMBL:AP005274) (90 aa)
FT                   fasta scores: E(): 6.5e-06, 33.33% id in 63 aa"
FT                   /db_xref="GOA:P67379"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67379"
FT                   /protein_id="CAD66702.1"
FT                   /translation="MSRKKHESSENNPVWFPTIMFGLMGTGAVWMVLFYISNGALPLPA
FT                   VGTWNILIAFGIIMAGFAMMSRWK"
     atgagcagaa aaaaacacga gtccagcgaa aataaccccg tgtggtttcc gacaattatg        60
     ttcgggctta tgggcaccgg ggctgtgtgg atggttctgt tctacatttc caacggcgcc       120
     ttgcctctgc cggcggtcgg aacatggaat atcctcatag cgttcggaat aatcatggcc       180
     ggatttgcaa tgatgtcacg ctggaagtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page