(data stored in ACNUC30630 zone)

EMBL: BX251410.PE100

BX251410.PE100       Location/Qualifiers
FT   CDS_pept        complement(110016..110624)
FT                   /transl_table=11
FT                   /locus_tag="TW109"
FT                   /product="putative NUDIX hydrolase"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein sco1775 sco1775 or sci51.15C SWALL:Q9S225
FT                   (EMBL:AL109848) (211 aa) fasta scores: E(): 6e-27, 46.74%
FT                   id in 169 aa, and to Bacillus subtilis adp-ribose
FT                   pyrophosphatase nudF SWALL:ADPP_BACSU (SWALL:P54570) (185
FT                   aa) fasta scores: E(): 1.1e-13, 33.15% id in 184 aa"
FT                   /protein_id="CAD66792.1"
FT                   /translation="MHYRVLESTLLHKGAVWDVVQEKLDYRGETISREFVSHPGAVGVL
FT                   ALNDKNEALLIRQYRHPIRTREWEIPAGMLDLSGESPLDAAKRELSEEVDMCAQTWHTL
FT                   IDFTLTPGGSNEVMRVYLARELRASQAKFNRKSEEADMEIAWIPMEDLLFSVLTRRVQN
FT                   PVLMLAALAAHEGLQVQWKYLRDADEPWPVYERLKGLIS"
     gtgcactaca gagtgcttga gtctaccctt ttacacaagg gtgcggtgtg ggacgttgtg        60
     caggaaaagc tcgattatcg cggcgaaaca attagtcggg agttcgtatc tcatcccggc       120
     gcagttggtg tgcttgcgct gaacgataag aatgaggctc tcctgataag acagtatcga       180
     cacccaattc gcacgagaga atgggaaatt cctgcaggca tgctcgatct atcgggcgaa       240
     tccccccttg atgctgccaa gcgtgagcta tcagaagaag tggatatgtg tgcacaaacc       300
     tggcacaccc tgattgattt caccttaact cccggtggaa gcaatgaggt gatgagagta       360
     tatctcgcgc gtgagctgag agcatctcag gctaagttca atagaaaatc agaagaagct       420
     gatatggaaa ttgcatggat tccgatggag gatttgttat tttctgttct cacaaggaga       480
     gtacagaatc cagttcttat gctggcagcc cttgctgcgc atgagggctt gcaggtgcaa       540
     tggaaatatc tgagagatgc agatgagccc tggccggtct atgaaagatt aaagggcctc       600
     ataagttag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page