(data stored in ACNUC30630 zone)

EMBL: BX251410.PE104

BX251410.PE104       Location/Qualifiers
FT   CDS_pept        complement(117757..124683)
FT                   /transl_table=11
FT                   /locus_tag="TW113"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66796.1"
FT                   /translation="MVDTKKTYSVLPVVASLTAVTLITSGLYINPQTYTHAAEQTKEAS
FT                   QQPVDLPGRDIWLPKHISTTEQAKAFAAYFTEKTHLPTHVSGTDVYVKTYAGPDKITGT
FT                   ISFTSSSSTTPATGKYPSAVSFLNSGDHKGWLKVSPGSLTSDVSGTYTATAEYKSADSS
FT                   TVLSASYTFHVYDEYAVTLVTRGEASLTSALKTQYSGGLSLFGTVSQRPPACRGVDCVH
FT                   NNQLSIPQGLQLVNPVQGILGGTVTAAPGYYTFGLVDSTKRSTATINDIVAVVEMIVQE
FT                   HPTLDSADISVGPGSQVSYDQRPFPGRTLGGPDVTYTLTDQKPDKKPGQEIEEGKYTLP
FT                   SGLSFNSTTGRISGTVSKTQQAHTYPLTVRTHQNYGELAKLFDLKPSQAVATIVISVVT
FT                   PPRVTYGTTTIDSSTGTITSAIPTNLDSQALKFSIRTKPYGLDALSIDTFTGALRGNID
FT                   SGNRLYPVPPEGVYRVVVEAKNQLGQSAYFDAPVTVGEHVSFVGRPIPSDPLDKNRTHV
FT                   VAGVAYSLSPASGNQDNPLSQPTSVSYYRLADGTNQNATTPGSDSLPKGLSLNPNTGTI
FT                   SGTVASTGDEIPASGTYSFRVIAVSLGGEKTEVTYTLRVEQPFVAGNSTVYVSTDQTLD
FT                   KTTGVLTGIVGGTDVTVSLPQGTNQNATTPGSNSLPKGLSLSVSGTGESSTASARSVHL
FT                   TGKPDGSVAPGRYLTRLSVTSGGVTKTVVLVVVVTKLALKDKARAELETQNISVYHQEG
FT                   QPSDPIYVSPPALTGVDGETVIYTLKSGSTLPAGLSLGHEGRLTGRLLGATGVSQFTVT
FT                   ISTRHSKSSIDLTYKITHLPVSLGKQTVTTSQGGTIVLPPSVTGLTTAGTYSIGEPDPK
FT                   SKKKKPEEGATSPDTHDKLPKGLHLSHETGTIYGVIDKTVKTGVYSFPLTLTYGDDKNK
FT                   KSVSAVVEIYVTQGDPIITPKNLVYYKGDTNPVKVKTLDGQDFSGLPITPTATDTNTYT
FT                   WSLYDSGSTEGTGIIPADNTLPRGLSLDKSTGKITGTIDSSVEYGTYTFRLRATNATGG
FT                   YGVADISLIYVTKPHTTPISPVTNPVYAAPGGRVSIPQLDGKGGFKYTLVDARDQAETV
FT                   KKSDGPVQFGLPTGLSLNPETGYVSGTVGKTVLPGTYVFGVKVSADSLDTGRFPGSSET
FT                   IYYALTVTTRPVLESVDGPVYKSHHVTIPANLLNAGTGTTFSLSGSSSIDPGVNRYPQG
FT                   LSIDQSTGTLTGSVSSANPGSYTFRVLATTDGVSTEALYHLTVKTPPPFPTTTYSVVAG
FT                   YTPHTTGREPLKDRFSVYLDLSRKYPSYTWTFGRDTVQGTTPGENTVPLGLVLYSSEGA
FT                   LIGNVDKSVKPGLYSFDLVALDNGQYVSSLRVEITVFELDAVEYPENTLVKPGQQVSIT
FT                   PKVPTDLDQARKLTITAGSGAVPSLKPGDGRLPLGLTITKPSLTSSSKTSDGLGAIQGV
FT                   VDPRVEAGEYTAHIDVFQATGEQIPVGARRTVLVKIRVEGQATLLSPTQLVVTKQGASV
FT                   SFFPHIAGGQTFAFANGTSSSITPGPNRVPAGLGINPDTGLVQGTLGTDVEAGRYTFGI
FT                   TATGSQGTSPVTLQVTLLVSAIESRNYSVVAGRPVPVNKDTNTTGYTYALSSSSYSSVV
FT                   AGQGRIPRGITLDRTTGNITGTVGRTVAAGLYTFGVDVFSARGSRITTVMYSVSVTDVF
FT                   GTKPFSAAVTLGTQVSLPSGQDDGGSDFSFVNAAWSTTPGPNRVPRGVFLDPSTGSLKT
FT                   LNPLSGVQPGIYTFTLSFGPRGRRSSYLYTLAVLPPVTLSALQGDQITDEIAIPSGITL
FT                   SGLPKEYGIVVGADGSVTSKAITQPPGIYSLPYTTRYYGQPLYTSAPSTATLTVSSVSP
FT                   LSADVNDVNALFDKTPEESLKETLTFAFARGTSSSTTPGPNRVPAGLGIAGPTGRVAGF
FT                   FKTGIQNGVYTFTVDISTQSGKYLGSRLYTITIGAPGIDATVNLVKIAGIYQSTSPVIF
FT                   FPPTQEGTYSLSSTATYSATPGPNRVPLGLLLGRADGSLTGSVYGSSPGVYTFLVESTY
FT                   GQQLYRLTLKDTTPPPSHTQSAKPTEKPKEEKTPTESKGGGFWSKVGSGIAAPFKWIWH
FT                   GITWPFRKLFGSRSEAPSSTTNATGNTNGKTRVKRDTQKPPEHPLKSVNEQIKTVTGAV
FT                   NNFQKSVLTSLKDFFTYLTDTAHLKFLNSTKTGLTKINGWVTGITGPVNKYIDKIRDWG
FT                   LLDKDHKTTGTTLKVLEAVVNPLTSWLPSPLQVLASNVLESKGLVTWTKGTATKLICLI
FT                   PWIKTLPLCPADSGNSDKSSK"
     atggttgata cgaaaaaaac ctattctgtt ctgccggttg ttgcatcgct cactgctgta        60
     actcttataa cgtccggctt atacataaac ccacagacat acacacacgc tgctgagcaa       120
     actaaagagg caagccagca acctgtagac ctaccgggac gtgatatatg gctccccaag       180
     cacatatcaa ccactgaaca ggcaaaggcc tttgcagcat acttcacaga gaaaacccac       240
     ctacccacac atgtatctgg cacagatgta tacgtaaaaa catatgcagg accagacaag       300
     ataacaggaa ccatatcctt tacctcctcc tcatctacga caccagccac cggtaaatat       360
     ccatcagctg ttagctttct gaactcaggt gatcacaaag gatggctaaa ggtcagtccg       420
     ggaagcctaa ccagtgacgt atctgggaca tatacagcca ctgccgaata taagtcagct       480
     gattcatcca cagtgctctc tgcatcatat accttccatg tatatgatga gtatgcggta       540
     acccttgtta cacgcggtga agcatcccta acatctgctc taaagaccca atactcaggc       600
     ggtttatctc tctttggtac cgtttcccaa agaccacctg catgtcgtgg tgtggactgc       660
     gtgcataaca atcaactgag cattcctcag ggtctacaac tcgtcaaccc cgtacagggt       720
     attctaggtg gcactgttac agccgcaccc ggatattaca cctttggtct agtggactcc       780
     acaaagagat caaccgcaac aataaatgac attgttgcag tagtggagat gatagtccag       840
     gaacatccca cccttgactc tgctgatata tctgttggcc ccggctcaca ggtctcatat       900
     gaccagcgcc cctttcccgg cagaaccctg ggtggtccag atgttacata caccctaacc       960
     gaccaaaagc ctgataaaaa gcccggccaa gagatagaag aaggtaaata cactctaccc      1020
     agtggacttt cctttaactc cacaacaggg agaatctcag gtactgtctc aaagacccag      1080
     caggcccaca cataccccct aacagtacgc acccatcaga actatggaga acttgccaaa      1140
     ctatttgatc tcaaaccctc tcaggctgta gccaccatag ttatctctgt agtaacacca      1200
     ccacgtgtta cctatggaac aacaaccata gactcaagca caggcacaat aacctctgct      1260
     ataccaacta acctggattc ccaggccctc aaattctcca tcaggactaa gccatatggc      1320
     cttgatgccc tttccatcga tacctttaca ggtgctctgc gtggcaatat tgattccggt      1380
     aatcgtctat atcctgttcc accagagggt gtatacaggg tggttgtaga ggctaagaat      1440
     cagctgggcc agtctgccta ttttgatgca cccgtaactg ttggtgagca tgtaagcttc      1500
     gttggtcgtc cgattccatc tgacccactg gataagaaca gaacacatgt tgtggcaggt      1560
     gttgcctata gcctatcccc tgcgtctggt aatcaagata accccctctc tcaaccaacc      1620
     agtgtctctt actatcgcct ggcagacgga acaaatcaga atgcaacaac accaggatct      1680
     gatagtcttc ccaaagggct aagtcttaat cccaatacag gtaccatatc tggcactgtt      1740
     gcttcaacag gtgatgagat acccgcttct ggcacatact cattcagagt tattgcagtt      1800
     tctctcggcg gagaaaaaac agaggttaca tatactctcc gagtagagca accctttgta      1860
     gcaggtaact ctaccgtata tgtcagcaca gaccagaccc tggataagac aacaggtgtt      1920
     ctaacaggta tagtcggtgg cacagatgtt acagtctctc ttccacaggg aacaaatcag      1980
     aatgcaacaa caccaggatc taatagtctt cccaaagggc taagtctttc tgtctcaggc      2040
     acaggtgaat cctctacagc atctgccaga tcagtacatc taacaggtaa gcctgatggg      2100
     tctgttgcac cgggaagata tctaacccgt ctatcagtaa caagcggggg tgtaacaaaa      2160
     actgttgttc ttgtcgtagt agtaacaaaa cttgctctca aggataaggc tcgtgcagaa      2220
     cttgagacac agaatatctc tgtttatcac caagagggcc aaccctctga ccctatctat      2280
     gtgtcccctc ctgccctaac aggtgtagat ggtgaaactg ttatatacac cctaaagagt      2340
     ggcagtacac ttcccgcagg tctcagtcta ggccatgagg gaaggctgac aggcagactc      2400
     ttaggtgcca caggtgtctc acagttcaca gttaccataa gcaccagaca cagcaagagc      2460
     tctatcgacc taacctataa gataacccac ctgcccgtat ctctcggtaa acagaccgtt      2520
     acaacatccc agggcggaac aattgttcta cctccatcag ttaccggtct taccactgcc      2580
     ggcacttatt ccataggtga accagacccc aagagtaaga aaaagaaacc cgaagaaggt      2640
     gcaacatcac ctgacacaca cgataaactg cccaagggtt tacatctgag tcatgagaca      2700
     ggaaccatat acggcgtaat agataagact gtcaaaacag gcgtgtatag cttcccccta      2760
     acactcacct atggggatga taagaataag aaatctgttt ctgctgtagt agagatatat      2820
     gtaacacagg gtgatcctat tatcacaccc aagaatcttg tctattacaa aggtgatact      2880
     aatcctgtca aggtcaagac cctagacggt caggactttt caggcctacc tataacccca      2940
     accgcaacag acactaatac atatacatgg tctctctatg actctggtag cactgagggc      3000
     acaggtatca ttcctgcaga taatactctg cccaggggtc ttagtctgga taaaagcaca      3060
     ggtaagataa caggaactat agattcttct gttgagtatg gaacatacac ctttaggcta      3120
     agggcaacca atgcaacagg tggctatggt gtagcagata tatcactgat atatgtaaca      3180
     aagccacaca ccacaccaat cagtcctgtt actaatcctg tatatgcagc acctggtggg      3240
     cgtgtcagca tacctcagtt ggatggaaag ggtggattca aatacactct cgtagatgcc      3300
     cgtgaccagg cagagacagt aaagaagagt gacggacccg ttcagtttgg gttaccaaca      3360
     ggcctaagcc tgaatcctga aacaggatat gtgagtggca ctgtcggaaa aaccgttctc      3420
     cccgggacat atgtctttgg tgtgaaggta tctgctgaca gcctggatac aggtcgcttc      3480
     cccggctcat cagagaccat ttattatgca ctgacagtta caacacgtcc tgttcttgag      3540
     tcagtagatg gacccgtgta taagtctcat cacgttacca tcccggctaa cctgctcaat      3600
     gcggggactg gcacaacctt ctccctatca ggatcatcca gtatcgatcc gggtgtcaat      3660
     agatatccac agggtctttc tatagatcaa tcaacaggca ccctaacagg ctctgtctca      3720
     tctgctaatc ccggttccta tacattcaga gttcttgcca caacagatgg tgtctcaact      3780
     gaggccctat atcatctaac ggtaaagacc ccaccgccat ttccaaccac aacatactct      3840
     gttgttgccg gttacacacc ccatacaacc gggagagagc ctctaaagga caggttctct      3900
     gtttatctgg atctctccag gaaataccct tcctatacat ggacctttgg tagagataca      3960
     gtccagggca caactccggg tgaaaatact gttcctctag gccttgtcct atacagctct      4020
     gaaggtgctc ttatcggtaa tgttgataag tctgttaagc caggccttta ttcattcgat      4080
     ctggttgctc tagacaatgg acaatatgtc tcatctctaa gagttgagat aactgtcttt      4140
     gaattagatg cagtagagta tcctgaaaac acccttgtaa agcccggaca acaggtctcc      4200
     ataactccca aggtcccaac tgatcttgat caggcacgca agctaacgat taccgcaggc      4260
     tcaggcgctg ttccatctct aaaaccgggt gacgggagac tcccccttgg ccttaccatt      4320
     acaaagccat ccctgacatc ctcatctaaa acatccgatg gcctcggtgc aatacagggc      4380
     gtagttgatc cccgtgttga agccggcgaa tacacagcac atatcgatgt cttccaggca      4440
     acaggagagc agatacctgt tggtgccaga agaactgttc tggtaaagat acgtgttgaa      4500
     gggcaggcaa ccctgctttc cccaacacag cttgttgtga caaagcaggg tgcatctgtc      4560
     tcgttcttcc cacatatagc aggaggtcaa acctttgcct ttgccaatgg aacatcatca      4620
     tccataacac caggacccaa cagagtcccc gcaggcctag gtataaaccc tgatacaggt      4680
     cttgtccaag gcacccttgg cacagacgta gaggcgggga gatacacctt tggtattaca      4740
     gcaacaggct cccaaggcac ctcacctgtc accttgcagg ttactctcct tgtctcagct      4800
     attgagagca gaaactactc tgtagtagcc gggcgccccg ttcctgtaaa taaagataca      4860
     aatacaaccg gatacaccta tgcattatca tcttcttcct attcctctgt agtagccgga      4920
     cagggaagaa tcccacgcgg aattaccctt gacaggacaa ctggtaacat aactggcaca      4980
     gtaggcagaa cagtagcagc tggtctatac acctttggtg ttgatgtctt ctcagcaaga      5040
     ggatcacgta tcacaactgt tatgtactct gtctctgtaa cagatgtatt tggaacaaaa      5100
     ccattctctg ctgctgttac cctaggaaca caggtcagcc tcccatcagg tcaggatgat      5160
     ggaggatcag acttttcctt tgtgaatgct gcctggtcaa caacaccagg acccaacaga      5220
     gtcccacgtg gtgtcttcct ggatccatca acaggttccc ttaagaccct gaacccactc      5280
     tcaggtgttc aacccgggat ctatacattc actctttcct ttggcccacg tggtagaagg      5340
     tcctcctatc tatacaccct tgctgtccta ccacctgtta ccctctctgc cctacagggt      5400
     gatcagataa cagatgaaat agctattcct tcaggaatca cactaagtgg cctgccgaag      5460
     gagtatggca tagtcgttgg tgcagatggg tctgttacct caaaggcaat aacacaaccc      5520
     ccaggcatct acagcctgcc atacacaacc aggtattacg gtcaacccct atacacctct      5580
     gcaccatcta ccgcaaccct aacagtctca tctgtttccc cactatcggc agatgtaaat      5640
     gacgtcaatg ccctgtttga caaaacccca gaagaatccc taaaggaaac tctaaccttt      5700
     gcctttgccc gtggaacatc atcatcaaca acaccaggac ccaacagagt ccccgcaggc      5760
     ctaggtatag caggaccaac aggacgtgtg gctggattct tcaagactgg catacaaaat      5820
     ggtgtctaca catttacagt tgatatctca actcagtcag gcaaatacct gggatcaagg      5880
     ctatacacaa taacaatagg tgcccctgga atagatgcca cagtgaatct ggtaaagata      5940
     gctggtatat accagtcaac ctcccccgta atcttctttc caccaacaca agagggaacc      6000
     tacagcctgt catcaacagc tacctatagt gcaacaccag gacccaacag agtcccactc      6060
     ggcctactcc tgggacgtgc agatggatca ctaacaggtt cggtctatgg ctcctctcca      6120
     ggtgtctaca cattcctggt agagagcacc tatggacaac agctctaccg actaacccta      6180
     aaagacacaa caccaccacc atcacacacc caatctgcca aacccacaga aaaacctaaa      6240
     gaagaaaaaa cacctacaga gagtaaagga gggggattct ggtcaaaagt aggtagtggt      6300
     atagctgcgc catttaaatg gatatggcat ggcataacat ggccattcag aaaattattc      6360
     ggtagtcgct ctgaagcccc ttcttcaacc accaacgcaa ccggtaacac caatggcaaa      6420
     acgcgcgtca aacgagatac gcaaaaacca cccgaacacc ctctcaagtc tgtcaatgag      6480
     cagataaaaa ctgtaaccgg tgctgtaaat aactttcaaa aatctgttct aacctctcta      6540
     aaggacttct tcacctacct aacagacaca gctcacctca aattcctaaa ctcaaccaaa      6600
     acaggactaa ccaaaataaa cggttgggta actggtataa ccgggcccgt caacaaatat      6660
     atagacaaga taagagactg gggtctatta gataaggatc ataaaacaac aggaacaacc      6720
     ctcaaagtcc tagaggcagt agtaaatccc cttacatcct ggttaccaag ccccctacag      6780
     gtcctagcca gtaatgttct agaatcaaaa ggtctagtca catggacaaa aggtacagct      6840
     acaaaactga tctgtctgat cccgtggata aaaaccctac ccctgtgtcc tgctgactct      6900
     ggtaactctg ataaatcctc caaataa                                          6927
//

If you have problems or comments...

PBIL Back to PBIL home page