(data stored in ACNUC30630 zone)

EMBL: BX251410.PE118

BX251410.PE118       Location/Qualifiers
FT   CDS_pept        134760..136832
FT                   /transl_table=11
FT                   /locus_tag="TW130"
FT                   /product="putative helicase regulator"
FT                   /note="Similar to Anabaena sp. hypothetical protein Alr4398
FT                   SWALL:Q8YP09 (EMBL:AP003596) (1075 aa) fasta scores: E():
FT                   9.6e-17, 26.54% id in 584 aa, and to Drosophila
FT                   melanogaster IswI protein or cg8625 SWALL:ISWI_DROME
FT                   (SWALL:Q24368) (1027 aa) fasta scores: E(): 2.3e-15, 26.16%
FT                   id in 474 aa"
FT                   /protein_id="CAD66810.1"
FT                   /translation="MTNAVIKDRTSHLLSALARTVREVEMSLVRKRIGPSSVMRFHAVA
FT                   LLLRQERARVKSDPDITDTVRTELIRRLDGLAAVMVRIAARDTALMSIVTPDAPVSDGA
FT                   LLYRRRLLSQIGVIDSDGESSEIREAAPPPPSLELYPQSVKMYHATHIFRPPGPDMESD
FT                   LVPIIRLANWDLVGSVFKAFSQGGASVCKSLPAPSPFLDRLAPDGLSMMPHQAGFVESA
FT                   RLGHRSFLLADEPGLGKTAQSLLAAGVTNSFPLLVVVPNVVKLNWVREAKMWLPGRRAT
FT                   IISGDDLDAFADIFVINYEMLDRHMLWMVDFGFAGMVVDEAHLIKNFSSQRSGNVLALA
FT                   QHIRKKCCNPLMIALTGTPVINSVEDFRALWLFLGWLAGPRGRDLSPVFVSELEKTGLT
FT                   PEDPGFSETVRDVMGHLGIVRRRKTQVAKDLPERMVVDLPVELDGDAFRSVKNAEDDLA
FT                   DALYAQYISLKHLRIDDYQIRLKAVERFAVESKDSSALNIFSIVRKIGITKAPLAIDFT
FT                   IQMLDSVGKIVFFAKHIEVMNMAEEMFCQQGIRSVSIRGSQTPNDRKNALRTFDEDPDT
FT                   RVAICSLTAAGLGINLQVASNVVLSELSWTAAEQGQAIDRLHRIGQTEPVTAWRILGAG
FT                   TVDIRMAALVDSKSNDAILSLDGGDMREVQQESLHIRSLLDLLDDRIRKAEQHVE"
     atgacaaacg cggttataaa ggacaggact tcgcatttac tgtcggctct tgcaagaact        60
     gtaagggagg ttgagatgtc cctggtgcgc aagagaatag gtccgtcatc tgtgatgcgt       120
     tttcatgcag tggctctgtt attgaggcaa gagcgagctc gcgtcaagtc tgaccctgac       180
     ataaccgata cagtacgcac tgaactcatt agacgactcg atgggcttgc tgctgttatg       240
     gtgcgtatcg ccgcaagaga cacagccctt atgtctattg ttacccccga tgctccggtt       300
     tctgatggcg cactgttgta tcgccggaga ttgctttctc agattggtgt tattgactct       360
     gatggggagt cttcagagat ccgcgaagcc gcgccgccgc ctcccagctt agaattgtat       420
     ccgcaaagcg tgaagatgta tcacgcaact catatctttc gtccgcccgg gccagatatg       480
     gaaagcgatc tagttccaat aataagattg gctaattggg accttgttgg ttccgtcttt       540
     aaggcttttt cccaaggcgg cgcgtcggtg tgcaagtcct tacctgcacc ttcaccattt       600
     cttgatcgac ttgcgcccga cggattgtcc atgatgccac atcaggccgg tttcgtagaa       660
     tctgcccgcc tgggtcatag gagttttctc ttggccgacg aacccggttt gggcaaaacg       720
     gcccagtcat tacttgccgc tggagtgaca aactcatttc cgcttttagt tgtcgttcca       780
     aatgttgtca agctcaattg ggtgcgtgag gccaaaatgt ggcttcccgg caggcgggca       840
     acgattatta gtggagatga tcttgatgcc tttgcggata ttttcgtcat aaattacgaa       900
     atgctggacc gtcacatgtt gtggatggtt gatttcggtt tcgcgggcat ggttgttgat       960
     gaggcacatc ttataaaaaa cttttcttcc cagcgctctg ggaatgtgct agcgttggct      1020
     caacacatac gaaagaaatg ctgtaacccc ctgatgatcg ccctgaccgg gactcctgtg      1080
     ataaacagtg tcgaagattt cagggctcta tggttatttt tggggtggct tgccggacct      1140
     cggggcaggg atctaagccc cgtttttgtc tctgagcttg agaaaacagg cttaacaccc      1200
     gaagatccgg ggttttctga aactgttagg gatgtgatgg ggcatcttgg aattgtacga      1260
     cgaagaaaaa cacaggttgc aaaggatctt ccagaaagaa tggtcgtaga tctgcctgtt      1320
     gaactggatg gcgacgcatt ccgcagtgta aaaaatgcgg aagatgatct ggcagatgcg      1380
     ctctatgcgc agtatatttc ccttaagcac cttagaatcg acgattacca aattcgcctg      1440
     aaggcagtgg agcgttttgc ggttgaatcg aaagactcta gtgcgttgaa tattttttct      1500
     attgtcagga agataggtat tacaaaagcg cccctcgcga ttgacttcac cattcagatg      1560
     ctggattccg ttggtaaaat cgtttttttt gcaaagcata tcgaggttat gaatatggct      1620
     gaggaaatgt tttgccagca gggcattcgt tctgtttcaa tcagggggag tcagacgcca      1680
     aatgaccgga aaaatgctct ccgtacattt gatgaggatc cggatacacg tgttgcaatt      1740
     tgctccctaa ccgctgctgg acttggcata aaccttcaag ttgcttctaa tgtagttttg      1800
     tcagaattga gttggactgc cgccgaacag ggtcaggcga ttgatagatt acatcgcatt      1860
     ggtcaaacgg agcccgtaac cgcctggcgc attctgggcg cgggtacggt tgatattaga      1920
     atggctgctt tagttgattc aaaatcaaat gatgcaatcc tgtctctgga tggcggagat      1980
     atgcgtgaag tacagcaaga gagtcttcat ataagatccc tccttgactt gcttgatgat      2040
     aggatacgta aggctgagca gcacgtagag taa                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page