(data stored in ACNUC30630 zone)

EMBL: BX251410.PE12

BX251410.PE12        Location/Qualifiers
FT   CDS_pept        12143..12715
FT                   /transl_table=11
FT                   /locus_tag="TW012"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein SMC00853 or R00853 SWALL:Q92RL3
FT                   (EMBL:AL591785) (182 aa) fasta scores: E(): 6.7e-26, 49.18%
FT                   id in 183 aa"
FT                   /protein_id="CAD66704.1"
FT                   /translation="MDGVFLWVTLGLALAIVVIAIFAWVAYNRLVAYNVRVDEAWSDIT
FT                   VQLKRRADLIPSLIETVKGYASHEKSVFKQVTLARAASIGASGVAEAAAADNQLQAALK
FT                   SIFAVAEAYPQLQASQNFLDLQAQLTDTENKIQASRRFYNGGVRDLNTLIGVFPSNIVA
FT                   RIAKFSTREFFDVERSEALQSPPKIVF"
     atggacgggg tttttctatg ggtcaccctg ggccttgcat tggccattgt tgttattgcg        60
     atttttgcct gggttgccta taatcgcctg gttgcgtaca atgtgcgtgt cgacgaggcg       120
     tggagtgata tcacggttca gctcaagcgg cgtgccgatc taattccttc tcttattgag       180
     actgtaaagg gctatgcatc ccatgagaaa tcggttttta aacaggttac ccttgctcgg       240
     gcagcaagta ttggtgctag cggggttgcc gaagcggcag cggccgacaa tcaacttcag       300
     gctgccttga agagtatttt tgccgttgcc gaggcgtatc cacaactgca ggcaagtcaa       360
     aactttctcg accttcaggc gcagctgact gataccgaga acaaaataca ggcgtcacgc       420
     aggttctata atggcggagt gcgtgatttg aataccctta ttggggtttt tccgtctaat       480
     atcgtggcta ggattgctaa gtttagtact cgtgagtttt ttgatgttga gcgatcagag       540
     gcccttcagt ctcccccgaa gattgttttc tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page