(data stored in ACNUC30630 zone)

EMBL: BX251410.PE120

BX251410.PE120       Location/Qualifiers
FT   CDS_pept        complement(138453..140111)
FT                   /transl_table=11
FT                   /locus_tag="TW132"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66812.1"
FT                   /translation="MIAYWGMIFGVVVLATLLRFYNLSDPKTLIFDETYYVKDAYTLYK
FT                   NGYESEWPRDMKPEDIDKRFVSGDTDFFTNEPEFLAHPHLGKYIIGAGIELFGVRSQFG
FT                   WRIAVALIGVLGVFMTAVIAARLFESTLIGGIAGFLFAIENNAIVMSRVAILDNVLMII
FT                   SLIAVWCVLLDRQWYRKAMSKWVQNRSKHLSQDAKGNYLVSGPLVWWRPWLALAAVLMG
FT                   MAASVKWSGIFYYFGIIPYITAIDWTTRKQLGIKYRFQGTFYQVLVSGISSVIISVFVY
FT                   IALWANYFIVGGWGSSWATYPGNGWAGPLAWVPKIFQSWVNFQVTMYRFNSTLTTPHIY
FT                   EAPVYTWPFLIRPTNMYWTKIGDDVRVIIGLPNPLLWWAAVALFIIFALIAIFAPSRRD
FT                   WRMNFILMTLAGGYFPWFLYVNRTIFHFYTIVFEPFMIIMIAAAIYKILEIKTENRLLP
FT                   TPWVGTRRFEYGSRVLAALRGSGNRVREACFVMPARIASLDIAPVMQAPLLRLMLVVTF
FT                   LLAATVCGFVILPINMAWPVHYKYWESLMILPSWK"
     atgattgcct attggggcat gatatttggg gttgtcgttc tggcaaccct gctgcgtttt        60
     tacaacctat cagacccaaa aactctgatt tttgacgaaa cttactacgt caaagacgct       120
     tacactctgt acaaaaacgg gtatgaatcc gaatggccac gagatatgaa gcccgaggat       180
     atagataaga gattcgtatc cggggatacc gattttttca caaatgaacc ggaatttcta       240
     gctcatccac atctaggtaa atacattatt ggcgcaggga ttgagttatt tggagtgaga       300
     agtcaattcg gttggcggat tgcggttgcc ctaatagggg tgctcggggt ctttatgaca       360
     gctgttatag ccgccaggtt atttgagagc accctcatag gggggattgc gggctttctg       420
     tttgcgatag aaaacaatgc aattgtaatg agtcgggttg ccatactcga caatgtgctg       480
     atgataattt cattgattgc ggtatggtgc gttttgctgg atcgacaatg gtacagaaaa       540
     gccatgtcaa agtgggttca gaatcgaagt aagcacctca gccaagatgc aaagggcaat       600
     tacctcgtct cagggccgct cgtgtggtgg cgaccatggc ttgcccttgc tgctgttttg       660
     atgggtatgg ctgcctctgt gaaatggtca ggtatttttt attacttcgg gataatcccg       720
     tacataacgg caattgactg gacaacgcgc aagcagcttg gtatcaaata tcgctttcag       780
     ggaaccttct accaggtact tgtctcgggt atcagttcag ttatcatttc cgtgtttgtc       840
     tacatcgcgc tatgggcaaa ttacttcatt gtaggtgggt ggggctcaag ctgggcaacc       900
     tatccaggaa atgggtgggc aggaccgctt gcatgggtgc caaagatatt ccagagctgg       960
     gtgaattttc aggtaactat gtacagattt aactccactc ttacaacccc tcatatctat      1020
     gaagccccag tgtatacgtg gcctttcctt attagaccca cgaatatgta ctggacaaag      1080
     attggtgatg atgtgcgggt tataatcggc ctgccaaacc ccttgctttg gtgggcagcc      1140
     gtagctctgt tcatcatttt tgcactaatc gctatttttg caccgagtcg acgtgattgg      1200
     cgtatgaatt ttatacttat gactctcgct ggtggatact ttccttggtt tttgtacgtt      1260
     aacagaacta tctttcattt ctataccatt gtctttgagc cgtttatgat aatcatgatt      1320
     gctgctgcaa tctacaagat tctggaaata aaaaccgaaa ataggctttt gccaacacca      1380
     tgggtgggaa cgcgacgatt tgagtatgga tcccgggtgc ttgcggctct gcgtggaagc      1440
     ggtaaccgtg tgcgcgaagc gtgttttgtt atgccagcac gaattgccag cctggatatt      1500
     gcgcctgtta tgcaagcccc tcttctgcgg cttatgttgg ttgtaacatt cctcctggcg      1560
     gcaaccgtgt gtggcttcgt catcctaccg atcaatatgg catggccggt gcactataaa      1620
     tattgggaaa gcctgatgat tttacccagc tggaagtaa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page