(data stored in ACNUC30630 zone)

EMBL: BX251410.PE122

BX251410.PE122       Location/Qualifiers
FT   CDS_pept        142042..142350
FT                   /transl_table=11
FT                   /locus_tag="TW134"
FT                   /product="WhiB-like regulatory protein"
FT                   /note="Similar to Streptomyces griseocarneus WhiB-STV
FT                   protein SWALL:Q06387 (EMBL:X68708) (87 aa) fasta scores:
FT                   E(): 1.6e-20, 80% id in 70 aa, and to Streptomyces
FT                   coelicolor regulatory protein WhiB or SCO3034 or SCE34.15C
FT                   SWALL:Q53963 (EMBL:X62287) (87 aa) fasta scores: E():
FT                   1.6e-20, 80% id in 70 aa"
FT                   /protein_id="CAD66814.1"
FT                   /translation="MSDNLPIPDDWHIDPVLLGIPGLRGGFDWRARALCAQADPESFFP
FT                   EKGGSTREAKKVCSSCAVRSECLEYALENDERYGIWGGTSERERRILRQRRAASGLA"
     gtgtcagata acttgccgat accggatgac tggcatattg accctgtttt gcttggtatt        60
     cccggattgc gaggtgggtt tgactggcgc gcaagggccc tttgtgcaca agctgacccg       120
     gagtcttttt tcccggaaaa gggcggttca acgagggagg caaagaaggt ttgttcgtcg       180
     tgcgcggtgc gttctgagtg cctcgagtat gcgcttgaaa atgatgaaag atatggcatc       240
     tggggtggca caagtgaacg cgagaggcgc attcttaggc agcgcagggc ggcttctggc       300
     cttgcatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page