(data stored in ACNUC30630 zone)

EMBL: BX251410.PE124

BX251410.PE124       Location/Qualifiers
FT   CDS_pept        144961..146340
FT                   /transl_table=11
FT                   /locus_tag="TW136"
FT                   /product="putative secreted protein"
FT                   /note="Similar to Streptomyces coelicolor putative secreted
FT                   protein SCO3032 or SCE34.13c SWALL:Q9KZL2 (EMBL:AL353862)
FT                   (506 aa) fasta scores: E(): 0.01, 24.83% id in 294 aa"
FT                   /protein_id="CAD66816.1"
FT                   /translation="MKIFPKILNCFILVLLPAIVFLFSGVHITTAVGVRHKTKVTSIEL
FT                   RLSCPGSLVGVGGVHARGISFVPLGNPSVLYAASQAGLLKAEHPSGVMLRGGYGTSGSQ
FT                   IQGLSSDRVKGLAAASCQQPRQESWLLGGATGVFDNTLLILGNPSDSQTSVSFTVYSGN
FT                   EKKFSSGVPVPSRSLRFVNLAGIAPGLSRIAVQVKSDDVPVYSVLQHSIVKGAVPMGVS
FT                   YVSTGNIDKSQYIPGVIINDNTINDNDNPQILLRLFVPGKDDADVSVSVVSKTTPGTAL
FT                   TAHVTGGSIRDIPISGLTSSSYFISITSSKPLLASALSSMSFQSGARDFAWYPATHATS
FT                   ADTFIAVPSRGVLALQNTLDQSQSVKLESLNGFSDSFPSGFVNTSHVFVPKQPEVTNST
FT                   VIHLDRSGVATHPVSRGFYRLSHKGQVAFSLAFVNSEGIAMYNPPTGDTRPDGITVDVL
FT                   Q"
     atgaaaattt ttccgaaaat acttaactgt tttattctgg ttttgttacc ggcgattgtc        60
     tttttattta gcggtgttca cataacaact gcagttggtg tgcgccacaa aaccaaggtt       120
     acatcgatcg aacttcggct gtcttgcccc ggctcacttg ttggtgttgg tggtgtgcat       180
     gcgcgcggga tatcttttgt tccgcttgga aacccatcag ttctttatgc cgcctctcag       240
     gcaggtcttt tgaaggcgga gcatccctct ggggttatgc ttcgtggagg ctacggcaca       300
     tctggttctc aaattcaggg gcttagctct gacagggtaa aaggcctggc cgccgcctca       360
     tgccagcaac ctcgtcagga gagttggctc ttgggcgggg caacaggtgt atttgataat       420
     acacttttga ttcttggtaa cccctctgat tctcagacca gtgtctcatt taccgtctac       480
     tcgggtaatg aaaagaaatt ctcctcgggt gtgccggttc ccagcagaag ccttaggttc       540
     gtaaatcttg cgggaatagc tcccgggctt tcaagaattg cggttcaggt caagtctgac       600
     gatgtcccgg tttattcagt tttgcagcac tccatagtca agggtgcagt tcccatgggg       660
     gtctcgtatg tatcgaccgg caacattgac aaaagtcaat atatccccgg ggtgattatc       720
     aatgacaata cgattaacga taatgataat ccccagattc tccttaggct atttgtgcca       780
     ggtaaagacg atgctgacgt ctctgttagt gttgtttcaa aaaccactcc gggcacagct       840
     cttactgcac atgtgaccgg agggtcaata cgagatatac caatttctgg ccttacatcc       900
     tcaagttatt ttatttctat tacaagctct aaaccgcttt tagcgtcagc cctgtcttct       960
     atgtcatttc agtcgggtgc acgggatttt gcgtggtatc cggcaaccca tgccacttct      1020
     gcggatactt ttattgccgt tccaagccgt ggcgtcttgg ctcttcaaaa tacccttgac      1080
     cagtcccagt ccgtaaaact tgaatccttg aatggatttt cggattcatt tcctagcggg      1140
     tttgtaaata catcacatgt ttttgtgcca aaacagccag aagtcacaaa ttcaaccgtg      1200
     atacatcttg atcgcagtgg cgtcgcgaca catccagtct cccgcgggtt ttacagatta      1260
     tcccataagg gccaagtggc attttcctta gcgtttgtta attcagaagg tattgcaatg      1320
     tacaatccac ctacgggcga cacacgaccc gatggtataa cagttgatgt gctgcagtga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page