(data stored in ACNUC30630 zone)

EMBL: BX251410.PE126

BX251410.PE126       Location/Qualifiers
FT   CDS_pept        148563..149258
FT                   /transl_table=11
FT                   /locus_tag="TW138"
FT                   /product="conserved hypothetical protein (possible
FT                   ATP-binding)"
FT                   /note="Similar to Corynebacterium glutamicum predicted
FT                   amidophosphoribosyltransferases Cgl0757 SWALL:BAB98150
FT                   (EMBL:AP005276) (196 aa) fasta scores: E(): 4.4e-06, 23.98%
FT                   id in 196 aa, and to Deinococcus radiodurans competence
FT                   protein ComF, putative dr1389 SWALL:Q9RUJ7 (EMBL:AE001984)
FT                   (219 aa) fasta scores: E(): 2.2e-05, 27.17% id in 195 aa"
FT                   /protein_id="CAD66818.1"
FT                   /translation="MSNLFYPTSCPCCGMQDTTLCDLCFARLAERPYRESLAGLDVISC
FT                   CDYTPTARAFITAYKVMKRMTLAKFMGLIIANQLNVFSSEYGNYSVITMPSTRLSWRSR
FT                   GFHPVDHALKTIGVEPVDLLCFRKQPKDQAFLDRRERMANMFGTLQVKKISTYSKNLLF
FT                   VDDVMTSAATLLEVHRAVSLTGKTLIGAVVLFRTRAKYPLGYNVRNKRSDSQSLKCTNH
FT                   FIPTFSITR"
     atgtctaatc tcttctatcc aacatcttgc ccttgctgcg gtatgcagga tactactctt        60
     tgtgacctat gttttgcgcg ccttgcagaa cggccttata gagaaagcct tgccggtctt       120
     gatgttattt cttgctgcga ttacacgccc acagcaaggg ccttcataac agcatacaaa       180
     gtaatgaaaa gaatgacgct tgcaaaattc atgggcttaa taattgccaa tcagcttaat       240
     gtgttttcta gtgagtacgg taactactcg gtaataacaa tgccatcaac cagattgagt       300
     tggcgcagca gggggtttca tccggttgat catgctctga aaactattgg cgtggaacct       360
     gtggatcttt tgtgttttag aaaacaaccc aaagatcaag cgtttttgga caggcgcgaa       420
     agaatggcaa atatgttcgg aaccttgcag gtgaagaaaa tatcaacata ttcgaagaat       480
     ttattattcg ttgatgacgt tatgacaagt gcggccactt tgttggaggt tcatcgcgct       540
     gtttcgctta ccggaaaaac cctaataggg gcggttgttc tattcaggac tcgggccaaa       600
     tatcctttgg ggtacaacgt ccgaaataaa cgctccgaca gccagtctct caaatgcacc       660
     aaccacttta ttcccacatt ttcaataacc cgataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page