(data stored in ACNUC30630 zone)

EMBL: BX251410.PE129

BX251410.PE129       Location/Qualifiers
FT   CDS_pept        152950..153696
FT                   /transl_table=11
FT                   /locus_tag="TW141"
FT                   /product="putative membrane/secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66821.1"
FT                   /translation="MKIRSKWFPDTRILIGLALIAASFIGVFFVIKTNNSKSQVYVATR
FT                   PLSIGDKFDAKQFSIVEANLGANLDKYITPGSLPNAVFNRPIMPGEFLPKSALVPVIDK
FT                   DIVAVVLRIAGDLPGDVKEGDLVDVWAAVKIKEEGFWQSELIAKTLRVSRVIVSTSQFD
FT                   PRGTTKVEVQASRDRLSYLLNAIANQDKVSIVRASHKEIELLRSASTPRTLDEQDKQNV
FT                   GETPDTNPRGPDEKDSNSESIHEGHE"
     atgaagattc gatccaaatg gtttccagac actcgtatat tgatcggcct tgccctaatt        60
     gcggcatcat tcatcggtgt tttttttgtt ataaaaacaa ataattccaa atctcaggtg       120
     tatgtggcaa caagacctct ctcgattggt gacaaatttg atgccaagca attttctatt       180
     gtcgaggcaa atctcggtgc gaatcttgat aaatacatca ccccgggcag cctaccgaac       240
     gctgttttca atcgaccaat tatgcccggg gagtttcttc cgaaatcagc actcgtaccc       300
     gtgattgata aggatattgt tgcggttgtg cttcgcatag cgggagattt accgggtgat       360
     gtaaaagagg gtgatcttgt tgatgtgtgg gcggcggtga aaataaaaga ggaaggcttt       420
     tggcagtctg aactaattgc aaaaacactt agggtgagtc gtgtcattgt ttctacaagc       480
     cagtttgacc cccgaggcac aacaaaagtt gaagttcagg ccagtagaga ccgcctgtca       540
     tacttactaa atgcaattgc aaatcaggat aaagtatcaa ttgtcagggc atctcacaaa       600
     gagattgagt tgcttagatc tgcctccaca ccgcgcaccc tcgatgaaca agacaaacag       660
     aatgttggag aaacacctga tactaatcct cgcggtccgg atgaaaaaga ttctaattca       720
     gagagcatac acgagggtca cgaatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page