(data stored in ACNUC30630 zone)

EMBL: BX251410.PE13

BX251410.PE13        Location/Qualifiers
FT   CDS_pept        12752..13627
FT                   /transl_table=11
FT                   /locus_tag="TW013"
FT                   /product="putative integral membrane heat shock protease"
FT                   /note="Similar to Streptococcus gordonii Challis probable
FT                   protease HtpX homolog SWALL:HTPX_STRGC (SWALL:O30795) (297
FT                   aa) fasta scores: E(): 1.5e-41, 42.52% id in 301 aa, and to
FT                   Escherichia coli probable protease HtpX or b1829
FT                   SWALL:HTPX_ECOLI (SWALL:P23894) (293 aa) fasta scores: E():
FT                   4.9e-17, 32.05% id in 287 aa"
FT                   /db_xref="GOA:Q83IG0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IG0"
FT                   /protein_id="CAD66705.1"
FT                   /translation="MMYSFIARNKINTFLILFVFILACGGFGLLAGRFLGMSFFLFILL
FT                   LAAGYACVQYFFSGRLAVLMSGARKISRNDNPRLWNTVENLSITTGLPMPEVYIVDDPA
FT                   PNAFATGRDPKHAKVAATSGLLEILDDSELEGVMAHEMGHVKNYDIRVSTIVFGLVSAV
FT                   GLISDMVLRALIWGDNRREGNSAFSFAIVLFFSLLAPIAAMLVQLAVSREREYLADATG
FT                   ALTTRYPAALASALAKLEGNARPLQRQSSSMAHLWISNPMPRGFFRKLFSTHPPTEERI
FT                   RRLKEMGNQF"
     ttgatgtaca gctttattgc gagaaacaaa atcaatacct ttttgatatt gtttgttttc        60
     atactggcct gcgggggttt tggcctgctt gccggcagat tcctcggtat gtcatttttt       120
     ctttttatct tgttattagc agcgggctat gcgtgtgtgc agtatttttt ctctggacgt       180
     ttagccgttt tgatgtcggg tgcccggaaa attagccgga acgacaaccc gcgcctctgg       240
     aatactgttg agaatttatc aataacaacc ggcttgccaa tgccggaggt gtacattgtt       300
     gacgaccccg cccctaatgc atttgcaaca ggccgcgacc caaaacatgc caaggttgcc       360
     gcaacatccg gtctgcttga gatacttgat gattccgagc ttgagggtgt catggcccac       420
     gaaatgggcc atgtaaagaa ctacgatata agggttagca ctatcgtttt tggcctcgtt       480
     tcagccgttg gccttatttc agatatggtc cttcgggctc taatttgggg ggataatcgt       540
     cgcgaaggaa attctgcctt ttcgtttgct attgtcttat ttttctccct ccttgccccc       600
     attgcggcaa tgctggttca gttggcggtt tccagggaaa gggagtattt ggcggatgca       660
     accggcgcct tgacaacaag atatcctgcc gccctggcct ctgcccttgc caaactggag       720
     ggcaatgcaa gaccgctgca aagacagagc agtagcatgg cccatttgtg gatttcaaac       780
     ccaatgcccc gggggttctt cagaaagctt ttttctaccc acccacccac cgaggagagg       840
     attaggcgat tgaaagaaat ggggaaccag ttctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page