(data stored in ACNUC30630 zone)

EMBL: BX251410.PE130

BX251410.PE130       Location/Qualifiers
FT   CDS_pept        153705..154487
FT                   /transl_table=11
FT                   /locus_tag="TW142"
FT                   /product="putative regulator"
FT                   /note="Similar to Bacillus subtilis sporulation initiation
FT                   inhibitor protein SoJ SWALL:SOJ_BACSU (SWALL:P37522) (253
FT                   aa) fasta scores: E(): 0.00051, 30.88% id in 136 aa"
FT                   /protein_id="CAD66822.1"
FT                   /translation="MGKTIAIWGPAGSPGRTTLSINIAATLASYGKKVILIDLDTFGGV
FT                   VSIYLGLDDQKSGLAAICYRADSRSFTPEDLLNIAIKVPIRGGLFYFLSGIAHHSRWPE
FT                   INQPSLLRVIGSAKSAFDYVVMDLSFALDSVGQDTRGRLNYTLMGSGDFLVMVGRGDPI
FT                   GICRFIRAWPEVPKAQNGRSLSIIPVINMVRHTAVGSRPTKQLREVICEYTSFQQVWQI
FT                   DFDQKVCDALLLRGKTIVDCMQNSSVAMQIASIGRVLQ"
     atgggtaaaa caattgctat atgggggccg gctgggtcac ctgggcgaac aacgctgtcg        60
     ataaatatcg ctgcaacact ggcctcttat ggcaagaaag ttattttaat tgacctagac       120
     acttttggtg gggttgtcag tatatattta gggcttgatg atcagaagtc tgggctggct       180
     gctatatgct acagggctga cagcagatca tttacacccg aagatctttt aaatatcgcc       240
     atcaaggttc cgatccgcgg aggattgttc tattttctaa gtggtattgc gcatcattcc       300
     aggtggcctg aaatcaatca accctcacta cttagagtaa taggatcggc aaaaagcgca       360
     tttgattatg tggttatgga tcttagtttt gcacttgaca gcgttgggca ggacactcgc       420
     ggccgcctaa attacactct tatgggttca ggcgattttc tggttatggt cggccgcggc       480
     gaccctattg gaatatgtcg ttttattagg gcttggccag aggtgccaaa ggcacaaaat       540
     ggcagatcgt tatcaataat tcccgttata aacatggtca ggcataccgc tgtcgggtca       600
     cgtcccacca aacagctgcg cgaagtaatt tgcgaataca cgtcttttca gcaggtatgg       660
     cagatcgatt ttgatcaaaa ggtttgtgat gctcttttat tgcgcggaaa aactattgtt       720
     gactgtatgc aaaacagttc tgttgcaatg cagatcgcct caattggacg ggtgcttcaa       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page