(data stored in ACNUC30630 zone)

EMBL: BX251410.PE131

BX251410.PE131       Location/Qualifiers
FT   CDS_pept        join(154524..154733,154735..155181)
FT                   /transl_table=11
FT                   /locus_tag="TW143"
FT                   /product="hypothetical phase-variable integral membrane
FT                   protein"
FT                   /note="No significant database matches. Frameshift at
FT                   potentially variable G(11) tract after aa 70"
FT                   /protein_id="CAD66823.1"
FT                   /translation="MSAFHSKVSPHVSSVVPTTNLTYKPNTRNIQVIRGIFKVITLCLI
FT                   KTLIITLCTMTFQTQTYAAQIQTSGGGARSLAEQEHNRTKRGANLFGLFASAVGTAVKT
FT                   KLKELKSTVQRKGKELQNTITRPLQQAVDNTVQTVVAQAAQSATQAVQSQPVQAQVQQL
FT                   TSTATSAVSTLANTVLDDLLGRAKETAKTVGYSLLGVLAAALTGFAIFAIVKWGR"
     atgtcagcat ttcactcgaa agtatctccg catgtatcta gtgttgtacc tacaactaat        60
     ctcacatata aacctaatac gaggaatatt caagtaatac gaggaatatt caaggtaata       120
     acactctgtc taataaagac tctcataata acactctgca ccatgacatt ccagacacag       180
     acatatgctg cccagataca gacttcaggg gggggggcac gctcactagc tgaacaagaa       240
     cataatagaa caaagagggg tgccaatctc tttggattat tcgctagtgc tgttggcaca       300
     gcagtcaaga cgaagctaaa agagctaaag agcacagtgc agagaaaagg aaaagaacta       360
     cagaacacca tcacaaggcc attgcaacaa gctgtagata acacggtaca gaccgttgta       420
     gcccaagcag cgcaatctgc cacacaggct gtccagtcac agcccgtaca ggcacaggtg       480
     caacaactta ccagcacagc aacaagcgct gtaagcactt tggctaatac tgttctagat       540
     gacctcctgg gcagagcaaa ggagacagcc aaaacagtcg gctactccct gctaggtgtg       600
     ctagctgcag cactaacagg ctttgccatc tttgccattg tcaaatgggg caggtaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page