(data stored in ACNUC30630 zone)

EMBL: BX251410.PE135

BX251410.PE135       Location/Qualifiers
FT   CDS_pept        complement(161570..162175)
FT                   /transl_table=11
FT                   /locus_tag="TW147"
FT                   /product="putative ABC transporter integral membrane
FT                   subunit"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein smc00963 r00889 or smc00963
FT                   SWALL:Q92RI2 (EMBL:AL591785) (201 aa) fasta scores: E():
FT                   2.3e-12, 34.23% id in 184 aa"
FT                   /protein_id="CAD66827.1"
FT                   /translation="MKVGVKVKEYNKDGQKYVGRRIPKTPVAVKLLGLAVYGVLMYNIS
FT                   GVYLLLLFLPSLLFFLRVSVAFIKQLIILVGIVSLVNLVFSGAEYAAYSALRMSALLAG
FT                   AYTVSRTTRFSEFLNFFIIVATPLRIFGLNQKRVGLTLSMTVRFVPEILTLHTQVREAQ
FT                   IARGVQKKPLAIFLPFTVLSLNMAQEIATAIASRGFED"
     gtgaaggtcg gtgtgaaggt gaaagagtat aacaaagacg gtcagaaata cgtaggcagg        60
     aggataccca aaacacctgt ggcggtaaaa ctgcttggcc ttgccgtcta cggagtgctt       120
     atgtacaaca tatctggtgt gtatctatta ctcttattcc tcccaagcct tttgttcttc       180
     ctcagggtct ccgtagcctt tataaagcaa ctgattattc tcgttgggat tgtttctcta       240
     gtaaaccttg ttttttcagg tgcagagtac gcggcttact cggcactcag gatgtcagca       300
     ctgcttgctg gcgcatacac cgtcagccgc acgacgcgat tctcagaatt cctgaacttc       360
     tttattattg tggcaacgcc tcttcggata tttgggttaa accaaaaaag ggtcggctta       420
     accctatcaa tgacagtccg atttgtgcca gaaatactga ccctacacac acaggttagg       480
     gaagcccaga ttgcgagggg ggttcaaaaa aagcccctcg caatcttcct gccatttaca       540
     gtcctaagcc ttaatatggc tcaggaaata gcaacagcaa tcgcttcacg cggatttgag       600
     gattga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page