(data stored in ACNUC30630 zone)

EMBL: BX251410.PE136

BX251410.PE136       Location/Qualifiers
FT   CDS_pept        complement(162302..162985)
FT                   /transl_table=11
FT                   /locus_tag="TW148"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="Similar to Deinococcus radiodurans ABC transporter,
FT                   ATP-binding protein dr2469 SWALL:Q9RRL9 (EMBL:AE002076)
FT                   (226 aa) fasta scores: E(): 3.2e-27, 42.98% id in 221 aa"
FT                   /protein_id="CAD66828.1"
FT                   /translation="MIAIEFSNVSLEIDDCKILREINLVFSAHRIGIIGVNGSGKSTLV
FT                   RLINGLHFPSNGCVKVDGIEVNKKTVKQIRRMVGFVFQNPQTQLVMPEVREDLKFGLKN
FT                   MGIQNIESAIEEVSVMLGIQNLLGRNTYQLSGGEKQMVALATILVTKPKVLVFDEPTTY
FT                   LDLMSFNRLSEIVNTLPQQIITISHNLDLIQTCNQVILMNQGQVAYDGPPKNAIAKYRE
FT                   LCKSA"
     atgatagcca tagaattcag taatgtaagc ctagaaattg acgattgtaa aattctgcga        60
     gagataaacc tggtgttcag tgcgcacagg attggcataa taggtgtaaa tggctctggt       120
     aagagcaccc ttgtgaggct tataaatggc ctacactttc cgtctaatgg atgtgtcaag       180
     gttgacggga ttgaggtaaa taagaaaacc gtaaaacaaa ttaggcggat ggttgggttc       240
     gtatttcaga atccacaaac ccaacttgtc atgccagagg tgcgagaaga tctgaagttt       300
     ggactgaaaa acatggggat tcaaaacatc gagtccgcca tagaagaggt ctccgtgatg       360
     cttggaatac agaatttgtt agggcgtaac acgtaccagc tgagcggcgg tgaaaaacaa       420
     atggttgccc tggcgacgat tcttgtcaca aaacccaagg ttttggtgtt tgatgagcca       480
     acaacatatt tggatcttat gagcttcaat agactgtctg agattgtaaa cacgttaccc       540
     caacagatta ttacaatcag ccataatctt gatttgatac aaacctgtaa ccaggtgata       600
     ttaatgaacc aaggacaagt agcctatgat ggacctccga aaaatgccat tgcgaagtac       660
     cgtgagctgt gtaaaagcgc atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page