(data stored in ACNUC30630 zone)

EMBL: BX251410.PE137

BX251410.PE137       Location/Qualifiers
FT   CDS_pept        163138..164073
FT                   /transl_table=11
FT                   /locus_tag="TW149"
FT                   /product="putative ABC transporter integral membrane
FT                   subunit"
FT                   /note="Similar to Streptomyces coelicolor putative peptide
FT                   transport system integral membrane protein SCO5118 or
FT                   SC9E12.03 SWALL:Q9F352 (EMBL:AL391751) (307 aa) fasta
FT                   scores: E(): 6.3e-45, 42.15% id in 306 aa, and to Bacillus
FT                   subtilis oligopeptide transport system permease protein
FT                   OppB SWALL:OPPB_BACSU (SWALL:P24138) (311 aa) fasta scores:
FT                   E(): 2.4e-28, 34.07% id in 314 aa"
FT                   /protein_id="CAD66829.1"
FT                   /translation="MGRYVLFRLLQFVPVFVGATFLIYLLVFLMPGDPIAALFGDKRPS
FT                   PDVVAAIREQYNLDKPFIVQYFIWFSGILTGNMGVTFSGQSVTEVLGSTIPVSAQLGFM
FT                   ALVIQLLLGLSVGLIAGLRPYRLFDTTSTLFLLALVSIPSFVLAFLLQFFIGIQLRLLP
FT                   VTVGGDTSFYRMLLPAFSLGLLGMVGYARVFRGEILKTRAQDFVNFAYSKGLSKARVIF
FT                   GHIVRNSLLVVVTLIGFDLAGLIGGAIITEGIFNVPGVGNVFYQATIRGEGPTIVSFSA
FT                   VFVIAFMLANLLVDISYSYIDPRIRLSGRK"
     ttggggcgct atgtcttgtt ccggctcctg cagtttgttc cggtgttcgt tggtgcgaca        60
     ttcctgattt atcttcttgt atttctcatg cctggggatc ccattgctgc acttttcggc       120
     gataaaaggc cgtcgcctga tgttgttgcg gcaattcgtg agcagtacaa ccttgataaa       180
     ccgttcattg tccaatattt catttggttt tctggcatac tcacgggcaa tatgggtgtt       240
     acattttctg gccagagtgt aaccgaggtt ctgggcagta caattccagt cagtgcgcaa       300
     cttgggttta tggcccttgt tatacaactt cttctgggtc tttcggttgg cctaatagct       360
     gggctgcggc cgtatagatt atttgacaca acgagcactc tgttcttact tgcccttgtt       420
     tcaataccat cttttgtgct cgcatttttg cttcagtttt ttataggaat tcagcttcgt       480
     cttctgcctg taacggtcgg tggtgacacc agcttttatc gaatgcttct gcccgcattc       540
     tcgctcggac ttctcggtat ggttgggtat gcccgagttt ttaggggtga aatcctcaaa       600
     acccgcgcac aagatttcgt taatttcgct tacagtaaag gtctctccaa agcccgggtt       660
     attttcggtc atatagtccg caatagcctc ctagttgttg tgactctaat tggttttgat       720
     ttggcaggtc taatcggcgg tgcgattata actgaaggca tattcaatgt cccaggggtt       780
     ggcaatgtgt tctaccaggc gacaattcgc ggagagggtc caacgattgt ttcgttttct       840
     gcagtttttg taattgcctt tatgcttgcg aatctcttgg ttgatatcag ttattcctac       900
     atcgacccga gaataaggct gtctggaaga aaataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page