(data stored in ACNUC30630 zone)

EMBL: BX251410.PE138

BX251410.PE138       Location/Qualifiers
FT   CDS_pept        164075..165040
FT                   /transl_table=11
FT                   /locus_tag="TW150"
FT                   /product="putative ABC transporter system integral membrane
FT                   subunit"
FT                   /note="Similar to Corynebacterium glutamicum ABC-type
FT                   transporter, permease components cgl1992 SWALL:BAB99385
FT                   (EMBL:AP005280) (333 aa) fasta scores: E(): 2.3e-50, 45.77%
FT                   id in 308 aa, and to Bacillus subtilis oligopeptide
FT                   transport system permease protein OppC or Spo0KC
FT                   SWALL:OPPC_BACSU (SWALL:P24139) (305 aa) fasta scores: E():
FT                   6.1e-29, 31.77% id in 299 aa"
FT                   /protein_id="CAD66830.1"
FT                   /translation="MSNNKSLDGYANPVEHYVAPFDEDDFSAPPDTSVGRRASKLRDIW
FT                   VYLRRRFAFWFSVVVLFTLTLAALFPGLFTRVPPNSDCYLKNSNGGPTGEHILGFTKQG
FT                   CDVFSRIVHGASTSLSVGLLTLAFALAIGVTIGALAGFFGGWVDAIISRAADIFFVIPF
FT                   LVAAIVVMSAFSSFRSVFTIALVLAVFGWPGTARLVRSEVYRVKNLEFVLAAHCLGQRK
FT                   WGILMKHIIPNSLSPIYSLAAISVGYAIISETVLSFLGLGLPSNVMSWGNDIASAQPDL
FT                   RNNPMTLFWPSLVLSVTVLAFTLLGDVIRKANNPAERSKG"
     gtgagcaata ataaatccct tgatggctat gccaatccgg tcgagcatta tgttgccccg        60
     tttgacgagg atgatttttc cgcacccccg gatacatctg ttggcagacg tgcttccaaa       120
     ctgcgcgata tatgggttta tctcaggcgc aggtttgcat tctggttttc tgtagttgtg       180
     ctttttaccc tcacccttgc tgctcttttt ccggggctat ttacacgtgt tccgccgaac       240
     agcgattgtt atttgaaaaa ttcgaacggc ggaccaacag gcgagcatat tctcgggttt       300
     acaaaacagg ggtgcgatgt cttttctcgc atagtgcatg gcgcctcgac atccctatcg       360
     gttgggctac ttacccttgc atttgctttg gcaatagggg ttacgatcgg tgccctcgct       420
     ggatttttcg gtggctgggt tgatgcaatt atttcgaggg ctgctgatat attcttcgtt       480
     attccgtttc ttgttgctgc aatcgttgtt atgagtgcgt tttcgtcatt ccgtagtgtt       540
     tttacaattg cacttgttct tgcagtcttc ggctggcccg ggacagcgcg tttggtaaga       600
     agtgaggttt atagagtaaa aaaccttgag tttgttttgg ccgctcattg cttgggtcaa       660
     agaaaatggg gtattttgat gaaacatata atcccgaatt ccctaagccc tatctattcc       720
     cttgccgcta tcagtgttgg ttatgccatt atctccgaga ctgtgctttc ttttcttggc       780
     cttggtcttc catcaaatgt gatgagttgg ggtaatgata tagcgtctgc acagcctgat       840
     ttacgcaata accccatgac tcttttctgg ccctctttgg tcctgtccgt cacggtactt       900
     gcctttacac ttcttggcga tgtaatacgc aaagccaata atccagctga aagatccaag       960
     ggatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page