(data stored in ACNUC30630 zone)

EMBL: BX251410.PE14

BX251410.PE14        Location/Qualifiers
FT   CDS_pept        13628..13999
FT                   /transl_table=11
FT                   /locus_tag="TW014"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO1562 or SCL11.18 SWALL:Q9L1C0
FT                   (EMBL:AL157953) (138 aa) fasta scores: E(): 1.2e-12, 41.02%
FT                   id in 117 aa"
FT                   /protein_id="CAD66706.1"
FT                   /translation="MAKVLFASYALLAVASLGRSAYQISTRFYEAPLAYSLSGFAAIVY
FT                   LVVFVSLVYSLRCLAYCALFIELIGVVVIGTLSIFAPGLFGTGNHIAATVWTLYGVGYF
FT                   FLPAALPVLGIIWLSRSKR"
     ttggctaagg tgttatttgc ctcctatgcg ttgcttgcag tggcttcgct tggcaggagc        60
     gcttatcaga tctcgactcg gttttatgag gccccccttg cctactccct ttcgggcttt       120
     gcggctattg tctatttagt cgtatttgtg tcccttgttt actccctcag atgtttggca       180
     tattgcgcgc tgtttattga gctaattggc gttgttgtta ttggcacctt gtccattttt       240
     gccccgggtc ttttcggcac tggaaatcat attgccgcaa ctgtctggac gttgtatggg       300
     gttggttatt tttttcttcc cgcggcactt cccgttcttg gcataatttg gctgtctaga       360
     tccaagagat ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page