(data stored in ACNUC30630 zone)

EMBL: BX251410.PE140

BX251410.PE140       Location/Qualifiers
FT   CDS_pept        complement(171897..172667)
FT                   /transl_table=11
FT                   /locus_tag="TW152"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66832.1"
FT                   /translation="MNRPIKTIRSRQCLVIFFFTLCLSVMFVILSLIATEWQYALLALI
FT                   LCVCSCLPFYVLFASPKLEVHQEYLRVVGPVRELRLPFDDIEEVLAAPMLTLKLKSGKV
FT                   ISCWGIIKRGRLLESEIQEARLSGEWSEIIPVSQSGQTYSSEIHPNLRAGTIRLDDEKE
FT                   REKGQYGGGHECNKHNAPEKDPLQKNPLQLSISHSEIPRGCTSAISSPEVGTEMGAEID
FT                   TRLISRSYNTLNIALLIVSCSLLFVSYFTLYYFQ"
     atgaatagac cgataaaaac catacgctcc aggcagtgcc ttgttatatt ctttttcacg        60
     ctttgcctgt ctgttatgtt tgttatcctg tccctaatcg caaccgaatg gcagtatgcg       120
     ctgcttgctc ttattctgtg tgtatgttca tgccttccgt tttacgtgct ttttgcctct       180
     ccaaaactgg aagtacacca ggagtatttg cgcgttgtag ggccagtgcg agagttgagg       240
     cttcccttcg atgatataga agaagtgctg gcagcgccca tgttgacctt gaagctaaag       300
     agtggcaaag tcatctcctg ctggggaatt ataaaaagag gaagactgtt agagtcagaa       360
     attcaggagg ccagactgag cggtgaatgg agtgaaataa ttcctgtcag tcagtctggg       420
     caaacgtatt cctcggaaat ccaccctaat ctgagggcag gaacgatccg gttggatgat       480
     gaaaaagaac gggaaaaggg gcagtatgga ggcgggcatg aatgcaacaa acacaatgcc       540
     cctgaaaaag atccgttgca gaaaaatcca ttgcagctca gcattagcca cagcgaaata       600
     ccgagaggct gcacctctgc aatatcgtcc ccagaggtgg gcacagagat gggcgccgaa       660
     atagacacca ggttgatctc aagatcgtat aatacactga atatcgcgct gcttattgtt       720
     agttgttctc tgttatttgt gtcatacttc acgctgtatt actttcaata g                771
//

If you have problems or comments...

PBIL Back to PBIL home page