(data stored in ACNUC30630 zone)

EMBL: BX251410.PE143

BX251410.PE143       Location/Qualifiers
FT   CDS_pept        179181..180542
FT                   /transl_table=11
FT                   /locus_tag="TW155"
FT                   /product="putative phospho-sugar mutase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   phospho-sugar mutase SCO4736 or sc6g4.14 SWALL:Q53876
FT                   (EMBL:AL031317) (452 aa) fasta scores: E(): 3.6e-76, 50% id
FT                   in 458 aa"
FT                   /db_xref="GOA:Q83NS5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NS5"
FT                   /protein_id="CAD66835.1"
FT                   /translation="MARLFGTDGIRALANGDLLTPELAMAVARAAAVVFTHGRVAKRRQ
FT                   VLGKRPVAIVARDPRISGDFLVAAISAGLASSGVDVLDAGVIPTPAVAFLVKNANADFG
FT                   FMISASHNPGYDNGVKIFAHGGVKLPDVVEDRIEYFLDKQKLSPIGSKVGRITRFVDAE
FT                   DRYQMHLLSTLFTRIDGVKVVIDCANGAASGVSPDVFKSAGAAVKVICADPNGVNINDG
FT                   VGSAYPERLRAEVIRNSATLGLAFDGDADRCIAVDSNGNTVDGDQIMAILARSMQQRGT
FT                   LRNKTLVTTIMSNIGLDRAMKKLGINLKRTQVGDRYVIEAMTQGGFNIGGEQSGHIILS
FT                   DYSTAGDGILAGLHLCAEIIRTGKSLTDLASIMEIVPQVTANIETDDPTTLLNNKKIRH
FT                   EISRIEKSLKGRVVIRPSGTEPLIRIMVEDLNPEKAERACSHLADFFKQEIQKS"
     ttggccaggc tgtttggaac agatggcata cgggcgctgg caaatggtga tttgctcacc        60
     ccagaactgg ccatggccgt cgcccgcgcc gccgccgtcg tctttaccca tggccgcgtt       120
     gcaaaaagaa ggcaggtctt aggcaagcga ccggtagcta ttgttgcgcg cgatcccagg       180
     atatcgggtg attttttggt agcggcaatt tccgcgggtc ttgccagctc tggggtagat       240
     gttctcgacg ctggggttat tccaactcca gccgtagcct ttttggtaaa aaacgcaaat       300
     gctgactttg gatttatgat atccgcatct cacaacccgg gttacgacaa tggtgtaaag       360
     atatttgccc atggtggggt gaaactgccc gatgtagttg aagaccgcat tgaatatttc       420
     ctggataaac agaaactgtc accgattggt tcaaaggttg gccggataac acgttttgtt       480
     gatgcagagg atcgatacca aatgcattta ctgtcaacct tgttcaccag aatagacggc       540
     gtgaaagtag taatagattg tgccaatggc gcagcgtctg gtgtttcacc agatgtattt       600
     aagtctgctg gtgctgcggt gaaggttatt tgcgcagacc cgaacggcgt taacataaac       660
     gatggtgttg gctcggcata cccagaaaga cttagggcag aagttattcg taactccgcc       720
     actctcggcc ttgcttttga cggcgatgct gatcgctgca tcgcggttga ttcaaacggc       780
     aacacggtcg acggggatca gataatggca attttggcca gatcaatgca acagcgcggc       840
     acactacgga ataaaaccct cgttacaacc attatgagca atattggcct tgatcgcgcc       900
     atgaaaaaac tcggtatcaa ccttaaaaga acgcaggttg gcgatagata cgtcattgag       960
     gccatgaccc aagggggatt caatattggc ggggagcaaa gcggccatat aatcctatct      1020
     gattattcaa ccgccggtga cggcattctt gcgggcctgc atctatgtgc ggaaatcatt      1080
     cgaaccggta aaagcttgac ggatctagct agcatcatgg agattgtccc gcaggtcacg      1140
     gcaaacatag aaacagatga tccaacaacc ctgctgaaca acaaaaaaat tcgccatgag      1200
     atatcacgca ttgaaaaatc tctaaagggt agagttgtaa ttcgtccaag tggcacagaa      1260
     cctcttatcc gtattatggt cgaggattta aatccggaga aagcggagcg cgcctgctcg      1320
     catttagcag attttttcaa acaggaaatc cagaagagct ag                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page