(data stored in ACNUC30630 zone)

EMBL: BX251410.PE145

BX251410.PE145       Location/Qualifiers
FT   CDS_pept        181855..183954
FT                   /transl_table=11
FT                   /locus_tag="TW157"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches. Has possible
FT                   N-terminal secretion signal sequence and 3 possible
FT                   membrane spanning regions in the C-terminal portion.
FT                   Similar to CDS TW161 - TW157 residues 8-275 identical to
FT                   TW161 residues 7-274, though not similar at sequence level
FT                   TW161 C-terminal portion also contains 3 possible membrane
FT                   spanning regions. Region following identity with TW161 is
FT                   an array of small repeats."
FT                   /protein_id="CAD66837.1"
FT                   /translation="MKKQYRHPLSYLTKAFTLLLTLLLLSSLQYETAFARQTPPALSLL
FT                   SSVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLSPQPQ
FT                   THIYVPYTDTSSYLYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVVSIT
FT                   KTTTNLIALLTTRNIFFFDIHVTEKPKITVPIHKQIDNTYLSDIPSLRNSRYTFSLTHP
FT                   NKDITIDRYTGQIHLSSLPTSPITAIAINKDTSTHITYAIDTHNPTTHNRSKRAAPRQS
FT                   SGYSWGDLFGNITSAAAGAITSALSGLANSFLGSSTTPSLSSTATGVSIGQSTITITPN
FT                   ARGSPTSYIATPTGATSGGANAAGLPKGLTLNSSGTITGSIDTGVSQGIYTVVVTATAS
FT                   KTSIVSATYTLLVTSTTPSLSGTTITIYTTTPVSLSVTGFITGYAINPTTPTDTSSQKT
FT                   HTVTINIDKTNGNITITPSIVPGTYTVTITATAPSYTSSATTLTSTIVIAVYTLVLSSM
FT                   KFFQRVKYYITKPFKAIYSWFSHTCTPVHHTTSQGFLGAATALLPAAVTSLVDAYNAFY
FT                   SAAHNSDACYDWKSYAYPVASLYGQVGIKALYRKISAHLPSFSGWGGKFFRAFMSAVSV
FT                   GAVYFLPFYLYGKLVKKPASSSGSGSNSNNSSLSGIIRNYFTGNWRTLLPGLFAPALTL
FT                   LTLWF"
     atgaaaaaac aatatagaca ccctctctct tacctcacca aagcctttac cttactatta        60
     acccttctcc tcctatcatc cctacaatat gaaacagcct ttgccagaca gacacctcct       120
     gccctatccc tcctatcatc tgtttcatct acatctgttt catctaatac caaatacaca       180
     agagtaagta atacaaatac acaagaagta tgtgtaacaa ctaacacaaa tgtatctctc       240
     ctaatagatc ctgttacaag cagtacaaaa caaaccctgt cctgcacccc atctctctca       300
     ccccaaccac agacacatat atatgtccca tacacagata catcctcata cctatatgtc       360
     ccatatataa ccaacacaca tatatccctc tattacacag ataagaaagc agatccatca       420
     tctttcctaa ccttccctca tacagacata gcaaccccat acggagatga gaaagtagtc       480
     tccataacaa agacaacaac caatctcata gctctcctaa caacccgtaa catcttcttc       540
     tttgacatac atgtaacaga gaaaccaaag ataactgttc ccatacacaa acagatagat       600
     aacacatatc tctcagacat accatcactc agaaactcca gatacacctt ctctctaaca       660
     cacccaaaca aagacataac catagataga tacaccggac agatacatct ctcatcccta       720
     ccaacatctc ccataacagc catagccata aacaaagaca caagcaccca tatcacctat       780
     gcaatagata cacacaaccc cacaacccat aacagatcta agagagctgc ccccaggcaa       840
     tcatccggat actcctgggg cgacctattc ggcaacataa ccagtgccgc agccggtgcc       900
     ataaccagtg ccctaagtgg actcgcaaac tccttcttgg gctccagtac cacaccatct       960
     ctatctagta cagccacagg tgtatctata ggtcagagta ctataactat tacacccaac      1020
     gcaagaggtt ctccaaccag ttatatagct acacctacag gtgctacatc aggtggagct      1080
     aatgccgcag gtctacctaa aggactaacc cttaattcct ctggaaccat aacaggaagt      1140
     atagatacag gtgttagcca aggtatatat acagtagtag taactgccac tgcatcaaaa      1200
     acatcaattg ttagtgcaac atataccctt cttgttacca gtactacacc atctctatct      1260
     ggtacaacca taaccatata cacaacaaca cctgtcagct tatctgtaac aggttttata      1320
     accggttacg caataaaccc aaccacccca acagacacat ccagtcaaaa aacccacacc      1380
     gtaaccatca atattgataa aaccaatggc aatataacaa tcaccccaag tattgtgcct      1440
     ggaacatata cagtaactat tactgcaact gcaccttcct atacttcctc tgctacaacc      1500
     cttactagca caattgttat tgctgtatat acccttgtgc taagtagtat gaaattcttc      1560
     caaagggtca aatactatat aaccaagcca ttcaaagcca tatacagttg gttctctcac      1620
     acttgcaccc cagtccacca cacaacaagc caaggtttcc ttggtgctgc caccgccctc      1680
     ctacctgccg cagtaacaag tctggttgat gcctacaatg ctttttactc tgcagcacat      1740
     aattcagatg catgttatga ctggaaaagc tatgcctatc cagtagcatc tctatatggg      1800
     caagttggca ttaaggcctt gtatagaaag atatctgccc atttacctag tttttctggc      1860
     tggggtggta agtttttccg agcttttatg tctgctgttt ctgttggagc tgtttacttc      1920
     ttgccgtttt atctttatgg taaattagtc aaaaagccag cttcatcctc cggttcggga      1980
     tctaattcaa ataattcaag tttgtcaggt attattcgta attatttcac tggtaattgg      2040
     cgaacgcttt tgccagggtt gtttgcccca gctttgactt tgttaacttt atggttctag      2100
//

If you have problems or comments...

PBIL Back to PBIL home page