(data stored in ACNUC30630 zone)

EMBL: BX251410.PE148

BX251410.PE148       Location/Qualifiers
FT   CDS_pept        191188..192282
FT                   /transl_table=11
FT                   /locus_tag="TW160"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   uncharacterized membrane proteins cgl2282 SWALL:BAB99675
FT                   (EMBL:AP005281) (264 aa) fasta scores: E(): 2.1e-24, 43.16%
FT                   id in 278 aa"
FT                   /protein_id="CAD66840.1"
FT                   /translation="MKDNHDRERKKWRRYLRREITEARIYEILATRFKQKQIFLDLAKA
FT                   EKRHAQHWRNLLGNEPDPKPKDFLLRLMAKYGSKVIVLSFLQRAEAKAPYFRDVNAVHM
FT                   AADETIHKEVIRAVAAPNRQSISGPFRAAVFGINDGLVSNTALIVTMAVFTDNITLLLL
FT                   TGFGGLLSGSLSMAAGEYVSVTSQKELINSNTPDPESYKALSNLSIDANELSLVYRARG
FT                   MTPAQAQHRANRVLEIVRHTDNLRLHVPDPITSNLNQHHSNTTGLPNDHNQALGNPWTA
FT                   AITSFILFATGALIPLLPFLIPIPIHLALPTSLTLFTLCLLITGAVIALLSGSNIIVKA
FT                   LRQLIIGALATILTSILTLFFGHH"
     atgaaagata accatgacag ggaaagaaaa aagtggcgcc ggtatctacg cagagaaata        60
     accgaggcgc gcatatacga aatactcgca acccgtttta aacaaaagca gatctttctc       120
     gatcttgcca aggcagaaaa gcgccacgca caacactggc gtaacttgct cggcaacgag       180
     ccggacccaa aaccaaagga tttcttgctg cgcctaatgg caaaatacgg tagcaaggta       240
     attgtattat cctttctgca aagagccgaa gcaaaggcac cctatttcag ggatgtaaat       300
     gccgttcata tggcagcaga tgaaacaata cacaaagagg taattcgcgc tgttgctgcc       360
     ccaaacagac aaagtatatc cgggcccttc cgtgcggccg tttttggtat aaatgatggc       420
     ctcgtctcga atacagcttt gatagtaaca atggcagttt ttacagacaa tataaccctc       480
     ctgctcctca ctggatttgg cggtctcttg tcgggcagtc tatcaatggc tgctggtgaa       540
     tatgtctctg tcacaagtca aaaagaactc ataaactcca acacacctga ccctgaaagt       600
     tacaaagccc ttagcaacct atcaatagat gcaaacgaac tgtctcttgt ataccgtgca       660
     aggggcatga ctcctgccca agctcagcat cgcgccaacc gtgtccttga aatagtgcgc       720
     cacacagaca atctccgcct tcacgtgccc gatccaatca catccaacct gaaccaacat       780
     cactccaata ctacaggtct accaaacgat cataaccaag cccttggcaa cccatggacc       840
     gctgccatta caagttttat cctgtttgct acaggcgccc ttatccctct cttgccattc       900
     ctaattccaa ttcccattca tcttgcttta ccaacctcac tgaccctctt tactctctgt       960
     cttttaataa caggtgcagt aattgccctt ttatcaggat caaacataat cgtcaaagcc      1020
     ttacgacaac taataatagg tgccttagca accattctga catctatcct cacactcttt      1080
     tttggtcacc actaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page