(data stored in ACNUC30630 zone)

EMBL: BX251410.PE15

BX251410.PE15        Location/Qualifiers
FT   CDS_pept        14121..15404
FT                   /transl_table=11
FT                   /locus_tag="TW015"
FT                   /product="WiSP family protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66707.1"
FT                   /translation="MRVGCLGKEVGLVRAQAIFRLVVLSILCVSVLLPTRWVLATPALK
FT                   PQSFSVAIGESLNRPPIPAAARGSVYTVNTKDLTAPGDGLPRGLDINRGTGTISGSVGS
FT                   DVLPGVYKPRVSVTSSAGSTSAVYTITVTRQIVLGDVLAQIKQGDPVRIPAKIIGGHSL
FT                   FNFRLAGKPRTTPGIAYPMGLSVDSKTGVLFGTVSYEVEYGVYNFLLWADEVIHGEIVS
FT                   HFAYYTLLVSPMHFNVDDQNFELQAYKPFQFPLSANGAAIAWVATGLPKGIYLSPAGLL
FT                   YGVPAVPPGEYSARLTVYGLEVRSGVLKIVSVTANLNILVAGEPIIYPQSITVKKGESV
FT                   SFPAKPPHKPGWVYWANMVDITTPGNGIPDGLILSPDNGTLYGAVSPSVQPGVYTPTVF
FT                   KAVPGEVEYAHSTTYTITVVEGTAPGAN"
     ttgcgcgttg gttgtttagg aaaagaggta ggcttggttc gtgcacaggc aatatttcgt        60
     cttgtagttt tgagcattct ttgtgtttca gtcttacttc caaccagatg ggtacttgcg       120
     acacctgcct tgaagccaca gtctttttct gtcgctattg gggaaagcct caatagacca       180
     cccattcctg ccgctgctcg cggttcggtg tataccgtaa acaccaagga cttaacggcc       240
     cccggcgatg ggttacctcg ggggctggat atcaaccgtg ggaccgggac catctccggc       300
     tctgtcgggt cagatgtact gccgggtgtt tacaagccga gggtatcggt gacctcctct       360
     gctggctcaa ctagcgcggt ttataccatc actgtgacca ggcagattgt tcttggtgat       420
     gttctggccc aaattaaaca gggtgatccg gtgcggattc ctgccaagat catcggtggg       480
     cattctctct ttaatttccg gcttgcaggc aagcctcgca ccacaccggg gattgcctat       540
     cccatgggtc tttctgttga ttcaaagacg ggcgtgctat tcggaacggt gtcatacgag       600
     gttgagtatg gggtatacaa ttttctgctt tgggcggatg aggtaattca cggtgagata       660
     gtgtcgcatt ttgcgtatta caccctcctc gtgtcaccga tgcattttaa tgttgatgac       720
     cagaactttg agctgcaggc ctataagccc tttcaatttc cactgagtgc gaatggtgct       780
     gctatagcct gggttgctac cggtcttcca aaggggattt atctttcccc agccggactt       840
     ctttatggcg tcccagctgt tccacctggc gagtatagcg cccggcttac cgtatacggc       900
     cttgaggttc gcagtggagt tttgaagatt gtttctgtaa cggcaaatct gaatattctt       960
     gttgctggtg agcctattat ttaccctcaa tctataactg ttaagaaggg tgagtccgtc      1020
     tcgttcccag ccaagccccc tcacaagcct ggctgggttt attgggcaaa catggtcgac      1080
     ataaccacac ccggtaatgg gatacccgat ggtttgattt tatctcctga caatggtacc      1140
     ctctatggtg ctgttagccc ctctgttcag ccaggtgtgt acacgccgac tgttttcaag      1200
     gcggttcctg gagaggttga atatgcgcac agtacaactt acacgatcac ggttgttgag      1260
     ggcactgcgc ctggggcaaa ctga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page