(data stored in ACNUC30630 zone)

EMBL: BX251410.PE152

BX251410.PE152       Location/Qualifiers
FT   CDS_pept        complement(202542..203240)
FT                   /transl_table=11
FT                   /locus_tag="TW164"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO2196 or SC5F7.05 or SC3H12.04
FT                   SWALL:Q9S2P0 (EMBL:AL096872) (234 aa) fasta scores: E():
FT                   5.7e-15, 31.89% id in 232 aa"
FT                   /protein_id="CAD66844.1"
FT                   /translation="MPKSNKKAPGRIAQIMQVLRIACSGRPKVVVYLIAAGITPLVAGI
FT                   SAAVILAYTSILVFILLILISVGAALLSFMITLGKQAEKVAYSQVEGRPGATGAVIKTF
FT                   RGCWQTSEIPVAVNPKTADAIYRAVGKCGVVLIIEGMRQRAQKMLAEEQRRVKRVLPNI
FT                   QIHVLNVNHLDPKSVPLNRLGKKMRSLKKTLHRSEVWKAGKLLDAIPKNYMPVPKGMDL
FT                   KKPVKRPSRG"
     atgccaaaga gtaacaagaa agcacccggg cgcattgcgc agataatgca ggttcttcgt        60
     atagcctgtt cgggtaggcc aaaggtggtt gtttatctga tagcagccgg catcactccg       120
     ctggtcgcgg ggattagtgc tgccgttatt ttggcctata cctcgatatt agtgtttatt       180
     cttttgattc taatctctgt tggtgctgca ttgttaagtt ttatgatcac acttggtaaa       240
     caagctgaaa aggtcgcgta tagccaggtg gagggccgcc ccggggcaac gggggctgtt       300
     ataaaaacct ttagaggatg ctggcagacc agtgagatac cagttgctgt gaaccctaaa       360
     actgcagatg caatatacag ggcagttggt aaatgtgggg ttgttctgat tatcgaggga       420
     atgagacaaa gggcccagaa aatgctggcc gaagaacagc gcagggtaaa acgtgtgctt       480
     cctaacatac agatccatgt tctgaatgta aaccatctag atccaaagtc cgtaccattg       540
     aatagacttg gtaaaaaaat gaggtcccta aagaaaaccc ttcatcgaag cgaagtgtgg       600
     aaggctggca agcttctgga tgccattcca aaaaattaca tgccagtacc aaagggaatg       660
     gatctaaaga aaccagtcaa gcgaccttca cggggttga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page