(data stored in ACNUC30630 zone)

EMBL: BX251410.PE153

BX251410.PE153       Location/Qualifiers
FT   CDS_pept        203335..204531
FT                   /transl_table=11
FT                   /locus_tag="TW165"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   serine/threonine protein kinase SCO1724 or SCI11.13
FT                   SWALL:Q9S2A6 (EMBL:AL096849) (550 aa) fasta scores: E():
FT                   0.0015, 30.3% id in 165 aa, and to Amycolatopsis
FT                   mediterranei serine/threonine kinase PkmA SWALL:Q9KK90
FT                   (EMBL:AF135382) (589 aa) fasta scores: E(): 0.0043, 25.59%
FT                   id in 168 aa"
FT                   /protein_id="CAD66845.1"
FT                   /translation="MIPFFNKHTRSTDDKDTEKARQIIGNYRVIKTLHESDRAVIYLAQ
FT                   EISGDPGMVARQSFMDPGELVNLVALKMYRAGVTSEHIAIEADALDSLRGPGVVELRDV
FT                   LNLPDKRGLVMRALHGPALVDLWETRGSLSPGEMVTILASLVATLARISSAGYAHGAVW
FT                   PGNIRFDDIGRPVLTGFSSARKHAPPNADWLDFYSLLRGCAVLINEKQEQMLQISAGVR
FT                   KRLDPFDPELPAWVEASLFRLADPQPLRFEHPISLHDTSGYNLRESPNPVDSNRQTGKS
FT                   QIILKLTDNKYVAAILGKLKRPSVLFIALFVSVFVVLLMVIPNNSGEDNERKSEKPGYV
FT                   KSKGTFKKPSKTGKSRKRSEVSEKLRKNMEECLASKDADCVDVMSEINADLGEKLDEG"
     gtgattccat tcttcaacaa acacacgcgt tcaacagatg acaaagacac agagaaagcc        60
     cgtcaaataa taggtaatta tcgtgtcata aaaactctgc atgaatctga ccgcgcggtt       120
     atttaccttg cacaggagat aagcggagat ccgggaatgg tagcccgcca atcattcatg       180
     gatcccggtg aattagtaaa tctcgtcgcc cttaaaatgt accgggcggg tgttacttct       240
     gaacacattg caattgaagc tgatgctctg gattcactca ggggtccggg tgttgttgaa       300
     ttgcgtgatg tcttaaattt gccggataaa aggggtcttg tgatgcgggc tttgcatgga       360
     cccgcacttg ttgacttatg ggaaaccagg ggcagtttga gtcctgggga aatggttaca       420
     attcttgctt cccttgtcgc aaccctcgca aggatttcat cagcaggcta tgctcatggt       480
     gctgtatggc ctggcaatat tcgtttcgat gatattggaa ggcccgttct gaccgggttt       540
     agctctgcca gaaagcatgc cccacctaat gcagactggc ttgattttta ttccttgttg       600
     cgggggtgtg cagtactcat aaacgaaaaa caagaacaaa tgttgcaaat atccgcaggg       660
     gtaagaaaaa gacttgatcc atttgatccg gaattacccg catgggtcga ggcaagtctt       720
     ttcaggctgg ccgatcccca gccactcagg tttgaacacc caatttcttt gcatgatact       780
     tctgggtata acttacgcga atcacccaat cctgttgatt ctaatagaca gaccggaaaa       840
     tcacagatta ttctgaaact aactgataac aaatacgttg ctgccatcct cggtaaacta       900
     aaacgtcctt ctgtgttgtt tatcgcactg ttcgtatctg tatttgttgt tcttttgatg       960
     gttatcccga ataactcagg agaggataat gagagaaaat cagaaaaacc cggatacgta      1020
     aaatctaaag gaacattcaa aaagcctagt aaaaccggta aatctcgtaa aaggtctgag      1080
     gtttctgaaa agcttaggaa gaatatggag gaatgtttgg ccagcaagga tgccgattgt      1140
     gtggatgtta tgtcagagat aaacgcagat cttggagaga aactcgatga aggttaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page