(data stored in ACNUC30630 zone)

EMBL: BX251410.PE158

BX251410.PE158       Location/Qualifiers
FT   CDS_pept        212254..213477
FT                   /transl_table=11
FT                   /locus_tag="TW171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3406 or SCE9.13c SWALL:Q9X8I6 (EMBL:AL049841)
FT                   (352 aa) fasta scores: E(): 2.6e-11, 32.66% id in 401 aa"
FT                   /db_xref="GOA:Q83I94"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I94"
FT                   /protein_id="CAD66850.1"
FT                   /translation="MLHRPRITPAVANARRAMLNTLPADLHNQLVLIALSGGRDSLAAM
FT                   VIASWVIPRLNGRVGAVVVDHGLQENSARIADEVRIRAEQFALNPILIKRVSPSRVSAG
FT                   PEASARIARYAAFYDTLEETKAYAIILAHTLDDQAETVLLGLMRGSGPSSLRGMKAVSY
FT                   TPEDCRYMNNKACNSVTAVYAHNTQRCSCDSRPYPPPPEPRNENRSYFPHPSCKCVEGS
FT                   ATRFTNADIDSRFGVFIRPFLDITRHETGKICEFYGLDYWNDPHNEDVRFSRVRIRHNV
FT                   MPVLENEIGPGVKYALSRTAKLAQLDTEYLDHLSNELLDEIASKESDWSIRLPINTLQK
FT                   TPVPIRLRVIRLAALQYFTVSLSFKHTRQIERLLCSSCDIKHVNLPRLITAQRVGNYIY
FT                   MHTLRGKL"
     gtgttgcaca ggccccgcat aactcctgca gttgcaaatg cacggcgcgc tatgctaaac        60
     acccttccag cggatttgca taatcaactc gttttgattg ctctttctgg cgggagagac       120
     tcgctggccg ctatggtaat cgcgtcatgg gttattccgc gcctgaacgg acgcgttggt       180
     gccgttgtgg tagaccatgg tttgcaggag aattctgcac gcattgctga cgaagtcaga       240
     atacgggcag agcagtttgc actaaatccc attctgataa agagagtctc gccctcgaga       300
     gtatctgctg ggccagaggc gtctgcccgc attgcacgct atgctgcctt ttatgatact       360
     cttgaagaaa ctaaagctta tgcgattatc cttgcccata cactcgatga tcaagcagaa       420
     acggttttac tcggcctcat gcgcggttcg ggcccgtcaa gtttgcgagg tatgaaggct       480
     gtatcgtaca ctccggaaga ttgcagatac atgaataata aggcgtgtaa ttccgtcacc       540
     gccgtgtatg cccacaatac acagcggtgt tcatgtgact cacgcccgta cccaccgcct       600
     cccgaaccgc gcaatgagaa cagaagttat tttccgcacc catcttgtaa atgcgtggag       660
     ggttccgcaa cgcgcttcac aaacgcagat atagattcgc gctttggcgt gtttataagg       720
     ccatttttgg atattacccg gcatgaaaca ggtaagattt gtgagttcta tgggctcgat       780
     tactggaatg atcctcataa tgaggatgtg cgtttttcgc gtgttcggat tcgtcacaat       840
     gttatgccgg ttttggaaaa tgaaattgga ccgggtgtta aatacgcgct atcgcgaacc       900
     gctaagttgg cacaattgga tactgaatat cttgatcatt tatcaaatga attgctcgat       960
     gagatagcgt ctaaagaatc agattggtca attaggctgc cgattaatac tcttcaaaaa      1020
     accccagtac ctattcgact tagggttata cgacttgctg ccctacagta ttttactgtt      1080
     agtttgagtt ttaaacacac ccgtcaaata gagagactac tgtgctcatc ttgtgacata      1140
     aagcatgtaa acctgccacg gttaattacg gcacagaggg ttggtaatta catttacatg      1200
     cacaccttac gcggtaaact gtaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page