(data stored in ACNUC30630 zone)

EMBL: BX251410.PE163

BX251410.PE163       Location/Qualifiers
FT   CDS_pept        218878..219327
FT                   /transl_table=11
FT                   /locus_tag="TW176"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66855.1"
FT                   /translation="MNKTAALVAALIVFSAVIAALASQVLSELGYSVFVPSYTFVFACL
FT                   ALALIQIILAIRIKLVLVKGKRAINPAFAYRILALARSYILAGSLFFGFFSGTALYFVR
FT                   GGFIPEKFYLLIPPAIASLIVIIAGVISKFLLRIPKNHGAAANLE"
     atgaataaaa ccgcagcgct cgtcgcggca ctgattgttt ttagtgctgt aatcgctgcc        60
     ctagcaagcc aggttctttc tgaacttgga tacagtgtgt ttgtcccatc gtacactttt       120
     gttttcgctt gcttggctct tgcattgata caaattattc tcgcgattag aataaaactc       180
     gttctcgtaa agggcaagag ggcaataaat ccagcctttg cttataggat tcttgctctt       240
     gcaaggagtt atatcttggc tggatcccta ttctttgggt ttttctctgg aaccgcactg       300
     tactttgtgc gagggggctt tattccagaa aagttttatt tacttatccc acctgccatt       360
     gcttcgttga ttgtaattat cgcgggtgtt atctctaagt ttctcttacg tatcccaaaa       420
     aaccacggtg cagccgcaaa cttagaatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page