(data stored in ACNUC30630 zone)

EMBL: BX251410.PE164

BX251410.PE164       Location/Qualifiers
FT   CDS_pept        219552..220313
FT                   /transl_table=11
FT                   /locus_tag="TW177"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="Similar to Lactococcus lactis NisF protein NisF
FT                   SWALL:Q48635 (EMBL:Z29363) (225 aa) fasta scores: E():
FT                   2.3e-15, 32.57% id in 221 aa"
FT                   /protein_id="CAD66856.1"
FT                   /translation="MAKLLDYIAESRVKKGELLFAADGLSKFYGKDAAIEGVSFEVRAG
FT                   DCVGLIGPNGGGKTTLINLILGFMPPSSGAIAFHSVLSTPTQRGLNTGIMLDIPAVPYG
FT                   LSVIRYFSLEARHRQLNDSDVYRYINDFDLASKRKKSFKSLSQGWKRRVLLVCLLMLSP
FT                   EFLVLDEPTNSLDIEGITWLREIIKARTQRGLTTFVSSHNHHELSQVVTRTLILKRQLR
FT                   YNGDLADLAKDGGDLEKAYFRLTDDSAVQYG"
     gtggcaaagc ttttggatta tattgccgag tcgcgtgtaa aaaaaggcga gcttctgttt        60
     gctgcggatg gcctttcaaa gttctacgga aaagatgccg ccatagaagg tgtgagtttc       120
     gaggttaggg cgggtgactg tgtcggcctt ataggtccaa acggtggtgg taaaaccacc       180
     ctcatcaacc tgattctcgg ctttatgcca ccgtcctccg gggcaatagc ctttcactcg       240
     gttctaagca caccgaccca gcgcggtctc aatactggga ttatgcttga tatcccggct       300
     gttccctatg gccttagcgt tattcgttat ttctcacttg aggcgaggca taggcaactg       360
     aatgacagtg atgtctatag gtacataaat gattttgatc ttgcttccaa gagaaagaag       420
     agcttcaagt cgctttccca gggttggaag cgaagggttc ttcttgtttg tcttctgatg       480
     ctgtctccag agttcttggt tcttgatgag ccaacgaaca gtcttgatat tgagggtatt       540
     acttggctta gggaaattat aaaagccagg acgcagcgcg gtcttacaac ttttgtatcg       600
     agccataatc atcatgagct ctcccaggtt gtaacccgca ctctgatcct gaagaggcag       660
     cttcgttaca atggtgatct tgcagacctg gccaaggatg gtggggatct tgagaaggct       720
     tatttccgtc ttacagatga tagtgcggtt cagtatggat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page