(data stored in ACNUC30630 zone)

EMBL: BX251410.PE165

BX251410.PE165       Location/Qualifiers
FT   CDS_pept        220402..221079
FT                   /transl_table=11
FT                   /locus_tag="TW178"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66857.1"
FT                   /translation="MTALSNWLLVSQGGVSHESVSKAIVSMPVSTITIFIPAVGIMFIS
FT                   RDFVSGYILRATLLLGDWRRFFFLRAIEAVVLSALFVLAICVLSVLFSSVFLAFAGYPV
FT                   GKAFSSDLFLSLLSCIPVSCVVGLMAYFLGWALRGAVVFMSVYFPYVFVADPVLSLLIP
FT                   NFVWFSYPGAVTRATNFFPTTPGEHALSGYTSPYIGFSVVLAYCAVAFLLAYFRNTRRG
FT                   GIL"
     ttgaccgcat tgtctaattg gttattagtc tctcaagggg gtgtctctca cgaatccgtc        60
     agtaaggcca ttgtttccat gcccgtgtcg accattacca tatttatccc ggctgtgggg       120
     attatgttta tttctaggga ttttgtaagt gggtatattc ttcgtgccac gctattgctt       180
     ggcgattggc gtaggttctt tttcttgaga gctattgagg ctgttgttct gtctgcactc       240
     tttgtgctgg ctatttgtgt tctgtcggtt cttttcagtt cagtctttct ggcctttgcc       300
     ggctacccgg ttgggaaggc ttttagttct gatctcttct tgtcgctttt gtcttgtatc       360
     cctgtatcgt gtgttgttgg cctcatggcg tattttcttg gctgggcttt gcgcggtgct       420
     gttgttttta tgtcggtcta ttttccatat gttttcgtcg ctgatccggt gctttcgctt       480
     cttatcccga attttgtctg gttttcctat cccggtgcag ttacgcgtgc cactaacttt       540
     tttccgacta caccgggtga acatgcactc tctgggtaca catctcccta tataggcttt       600
     tcggttgtat tggcatactg cgctgtcgcg ttcctattgg catatttcag aaatactaga       660
     cgtggtggca ttctctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page