(data stored in ACNUC30630 zone)

EMBL: BX251410.PE169

BX251410.PE169       Location/Qualifiers
FT   CDS_pept        223721..224497
FT                   /transl_table=11
FT                   /locus_tag="TW182"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66861.1"
FT                   /translation="MNRQSSFFPLLTGFFTYLFLLTRPHKRRLFMAGLVRKYYRDSTAR
FT                   TLIFDFYEYSVEGGILCLLLGVPSYIQLTEPLLLALVVALVALCVALIMHHSQYTLVLF
FT                   DDWGIDKRSFLLRYSYYSQTPSFQNPTKRRQILLLDTVTRYGSKWSRVYVATMAVCIFF
FT                   LVGTPISAWYLGALSFFACLFYTCFFTILPSIIFPFAFDGFPALLVRKLLYNLHIRRHG
FT                   PIPKELTDMVTQAYEIYPERLYPWFRSRKNQKCESR"
     atgaacagac aatcatcctt ctttcccctc ctaacaggtt tcttcaccta tctctttctc        60
     cttacaagac cacataagag aagactgttc atggcaggat tagttaggaa atattacaga       120
     gatagtactg cacgtacgtt gatctttgat ttttatgagt attctgtcga agggggtatt       180
     ttatgtcttc tgttgggtgt accttcctat atccaactta cagaaccgct cttacttgct       240
     ctggtggttg ctctggtggc actttgcgta gcactaatta tgcaccattc acagtatact       300
     ctcgtgctat tcgatgattg gggaattgat aaacgatcct tcctcctccg ctactcctat       360
     tactcacaaa ccccatcttt ccaaaaccca accaaacgca gacaaatcct cctgcttgac       420
     actgttacaa gatatggcag caaatggagc agagtgtatg tggctaccat ggctgtatgc       480
     attttttttc tagttggaac cccgattagt gcctggtatc tcggtgcgct atctttcttt       540
     gcttgccttt tttacacttg tttttttacg attctcccat cgatcatatt cccgttcgca       600
     ttcgatggtt tccccgccct cctagtccgc aaactcctat ataacctaca tataagaaga       660
     catggaccaa taccaaagga actaacagat atggttaccc aagcctatga gatatatcca       720
     gaaaggcttt atccttggtt ccgctcaagg aaaaaccaga aatgtgaaag ccggtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page