(data stored in ACNUC30630 zone)

EMBL: BX251410.PE170

BX251410.PE170       Location/Qualifiers
FT   CDS_pept        224723..225307
FT                   /transl_table=11
FT                   /locus_tag="TW184"
FT                   /product="putative peptidase"
FT                   /note="Similar to Aeromonas hydrophila type 4 prepilin-like
FT                   proteins leader peptide processing enzyme [includes: leader
FT                   peptidase tapD] SWALL:LEP4_AERHY (SWALL:P45794) (290 aa)
FT                   fasta scores: E(): 1.5e-05, 29.44% id in 197 aa, and to
FT                   Escherichia coli leader peptidase HopD SWALL:HOPD_ECOLI
FT                   (SWALL:O68932) (155 aa) fasta scores: E(): 0.0017, 32.7% id
FT                   in 159 aa"
FT                   /protein_id="CAD66862.1"
FT                   /translation="MTKPVAYSIYALIVILTGIGLGIIGLPFATLAFIAIFVSTPALFR
FT                   ADIRELRLPNAITLPLIAIGIVALLADQIVHPNLDIVFSALIAIGLSSFLFIVSIFGGM
FT                   GMGDVKLSLALLLCAANLGPAFPIIAISSAFLVAFCFCILIFVGLFRFFKNSGRISCLP
FT                   FGPFLLLGFWTTVIVWGIDRWTDVDILRIIW"
     atgacaaaac ccgtggcata ctctatctat gcacttatcg ttatcctgac tggtattggt        60
     ctgggtatta ttggacttcc ctttgccacc cttgcgttta tcgcgatttt cgtctcgact       120
     cctgctttgt ttagagctga tatcagagag ttacggcttc ccaatgcaat tacgcttccg       180
     cttatcgcaa ttggcattgt ggcgttactt gcggatcaga ttgttcaccc caatttggat       240
     attgtctttt ctgctcttat cgcaattggc ctatcctcat tcctttttat tgtgtctatt       300
     tttggcggta tgggaatggg ggatgtaaag ttatcgcttg ccctgctctt gtgtgcggcg       360
     aatctgggcc ctgccttccc tataattgca atctctagtg ccttccttgt ggcattctgt       420
     ttctgcatcc tgatatttgt aggtctcttt agattcttta aaaatagtgg gagaattagc       480
     tgtttgccgt ttgggccatt tttattgctt ggattctgga caactgttat tgtgtggggt       540
     atagacagat ggacagatgt ggatatcctc agaattattt ggtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page