(data stored in ACNUC30630 zone)

EMBL: BX251410.PE174

BX251410.PE174       Location/Qualifiers
FT   CDS_pept        228065..228706
FT                   /transl_table=11
FT                   /locus_tag="TW189"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Possible
FT                   coiled-coil region at residues 42-80."
FT                   /protein_id="CAD66866.1"
FT                   /translation="MRRKLLPVLLFSVFLWVCLPAQSAQAFLFDGKNNIFKQLQQTAEK
FT                   KLKELKGTAQKAVNTVKKKVEQAKHTAETKVKELQNTVATAVHNAVQPKPQKRPAKPVA
FT                   TKAPPAPKPSSSSAPSRVSPPTPPTHSSSASASVTHSSSIPSATHSSNSSSARESSGAT
FT                   STSSSSADAGKSVAAESSPGLLIPAAITAAVTVAITSITAVMYIVFSRFL"
     gtgaggcgga agctgcttcc cgttttgcta ttttctgttt ttctgtgggt ttgccttccc        60
     gcgcaatctg cccaggcttt tttatttgac ggtaagaata atatttttaa gcagctacag       120
     caaacggcag aaaagaaact aaaggaatta aagggtactg cacaaaaagc tgtaaacacg       180
     gtaaagaaga aggttgagca ggcgaagcat acggcggaaa ccaaggtaaa agaattacag       240
     aatacagtgg caaccgccgt gcataatgcg gtgcagccaa aaccccagaa gcgaccagca       300
     aagcctgttg ctacaaaggc ccctcctgca cccaagccat catccagctc tgctccctcg       360
     cgggtatcac cgcctacacc ccccactcac tcttctagcg cctcggcgtc ggtgactcat       420
     tcatcatcta ttccatctgc tactcattca tctaattctt ctagtgctcg cgagtcttct       480
     ggcgcaacca gtacctcatc ttcctcggcc gatgctggta aatctgttgc ggcagagtct       540
     tcacccggct tgcttatacc ggccgccata acggcagctg taacggttgc cattacatca       600
     attactgccg ttatgtatat cgtgttttct cgttttcttt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page