(data stored in ACNUC30630 zone)

EMBL: BX251410.PE177

BX251410.PE177       Location/Qualifiers
FT   CDS_pept        229953..230495
FT                   /transl_table=11
FT                   /locus_tag="TW192"
FT                   /product="possible integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66869.1"
FT                   /translation="MPKTNIKFLIITLSVIFSLIFIATPTYATTSVTTDKAVATTTEPK
FT                   ANQIIKELEQAGFTKQVTGNKRQETITLTKDGVTVTLTHVTQQTQTRLSWGDDPWGFYI
FT                   KLEWHEQVALAAGTLAAGGGAGLALKAALKIAVKAGTAFLAGLEVVDKLSDIIGAGPCP
FT                   PFQPRYIRFDPFRTKCG"
     atgcctaaga caaacataaa gttcctaata ataaccctct ccgtaatctt ctctctaata        60
     ttcatagcaa cacccacata cgcaacaaca tctgtaacaa cagataaagc agtagcaaca       120
     accacagaac caaaagccaa ccaaataatc aaagaactag aacaagcagg attcaccaaa       180
     caagtaacag gtaacaagag acaagaaaca ataaccctaa ccaaggatgg tgtaactgta       240
     acccttacac atgtaacaca acagacacag acaagacttt cctggggtga tgacccatgg       300
     ggtttctaca taaaactgga atggcatgaa caagttgccc ttgctgcagg cactcttgcc       360
     gctggtggcg gtgccggcct ggcccttaag gccgctctaa aaatagccgt gaaggcaggc       420
     accgcatttc tggctggcct ggaggtggta gacaagttga gtgacatcat tggcgcaggg       480
     ccctgccctc ccttccaacc ccgctacatc cgctttgatc ccttcagaac caagtgtggc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page