(data stored in ACNUC30630 zone)

EMBL: BX251410.PE182

BX251410.PE182       Location/Qualifiers
FT   CDS_pept        complement(235965..236714)
FT                   /transl_table=11
FT                   /locus_tag="TW197"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO3849 or SCH69.19c SWALL:Q9XA15
FT                   (EMBL:AL079308) (253 aa) fasta scores: E(): 9.6e-09, 25.6%
FT                   id in 250 aa"
FT                   /protein_id="CAD66874.1"
FT                   /translation="MIAKHTKRGVKFPRGEQAKPASGWSRIVMIFGELSMTAGVLVGIF
FT                   YTWVLYIDSPLTAWEQGNSANLTASQFMRHRSDATETMPVTDRVKDYEDIAVLFVPRFG
FT                   NKYKRVIRETTDVTRVLNSKTAGVGHYPHTALPGTSGNFAVAAHEVGWGAAFGKLSELR
FT                   LGDKIYVLTPKGWYIYAYRSSEYVKPDGVNVLRPLPQSFAVPDETYIMTMTTCNPPFSV
FT                   AERLIAYAVLEKWQADVPHEIVNIVNS"
     atgatcgcca aacatacaaa aaggggcgtc aaatttccgc gaggggaaca ggcaaaaccg        60
     gcgtcaggat ggtcgaggat tgtcatgata tttggcgaac tatcgatgac cgccggggta       120
     cttgttggga ttttctatac ctgggtttta tatatagact cacccttaac cgcatgggaa       180
     cagggcaata gcgcaaacct caccgcttct cagttcatgc gccacaggtc cgacgccacg       240
     gagactatgc cggttaccga cagggtaaag gattatgagg atatagcagt tttgttcgtt       300
     cctcgttttg gaaacaaata caagcgggta attagagaaa ctacggatgt tacgcgcgtt       360
     ttgaacagca aaaccgctgg agttgggcac tacccgcata ccgcgctacc tggcacatcc       420
     ggtaactttg ctgttgcagc acatgaagtt gggtggggcg cggcttttgg aaaattgtca       480
     gaacttcggc tgggtgacaa aatctatgtt ttgacgccaa agggttggta catatacgcg       540
     tatcggagca gtgagtacgt aaaacccgat ggggtgaatg tcctgcggcc tttgccacag       600
     tcatttgctg ttccagacga aacctatatt atgacgatga caacatgtaa tccaccattc       660
     tctgtagccg agaggcttat cgcatatgcg gttcttgaaa aatggcaagc agacgtacca       720
     catgaaatag tgaatattgt aaacagctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page