(data stored in ACNUC30630 zone)

EMBL: BX251410.PE185

BX251410.PE185       Location/Qualifiers
FT   CDS_pept        237969..239126
FT                   /transl_table=11
FT                   /locus_tag="TW200"
FT                   /product="putative ABC transporter branched chain amino
FT                   acid binding protein"
FT                   /note="Similar to Pseudomonas aeruginosa leucine-,
FT                   isoleucine-, valine-, threonine-, and alanine-binding
FT                   protein precursor BraC or pa1074 SWALL:BRAC_PSEAE
FT                   (SWALL:P21175) (373 aa) fasta scores: E(): 3.2e-22, 28.78%
FT                   id in 337 aa"
FT                   /protein_id="CAD66877.1"
FT                   /translation="MFFSGCFGSGDNKSSAEHIVLPKVTAPVSFKNALFPAGDGKAVCP
FT                   KGLSIAYVGIVTGPNAAFGKSINEAFQLAVKQHNDNNPGCQVTGKVFDTEGSPDKAPGV
FT                   VAQVIGDSSIVAVLGPAFSGENQAVGGIFETARLVHITPSATLPTLSSHGWKTFFRAAS
FT                   TDLEQSTGVIALLEKLEAKKTFVVSDDSAYGKFLGDLVKKGVDLAGSDGIITGSRDFSS
FT                   VVAKVVSSGADSVFFAGYYPEAAAFFTQLRGAGFNGYLVVPDGSLDRNLSKLAGQAAVG
FT                   VYAVCPCTDDSQVAGFGDAMKKAYGHYPGIYSSSAYDVTTILLRGIDSGRTSRSSLLDW
FT                   VRGYDAYGVSGHYKFKANGDLQHTRLYFYRFDESGAPVLVGEYSK"
     ttgttcttca gcgggtgttt tggctcgggt gataataagt cgagtgcgga acatatagtc        60
     cttccaaaag tcacagctcc tgtctcgttt aagaatgcgc tatttcccgc aggtgatggt       120
     aaggcggtgt gtcctaaggg tctttctatt gcctatgtcg gtattgttac cggtccgaat       180
     gccgcctttg ggaagagcat aaatgaggcg tttcaacttg ctgttaagca gcataacgac       240
     aataatcctg gctgtcaggt tacaggtaag gtgtttgaca cagagggatc gccggataaa       300
     gctcccggag ttgtcgcgca ggttattgga gactcctcga ttgttgcagt tcttggcccg       360
     gctttctcag gtgagaacca ggctgttggg ggtattttcg aaacggcgcg tcttgtacac       420
     ataactccga gtgcaaccct gccaacactt tcatctcacg gctggaagac gttcttcagg       480
     gccgcctcga ctgatctcga gcagtctacg ggggttattg ctttgctgga gaagctagag       540
     gccaaaaaga cttttgttgt gtctgatgac agtgcatacg gtaaattcct cggcgatctt       600
     gtaaaaaagg gtgtcgattt ggctggaagc gatggaatta taaccggcag tcgtgatttt       660
     tcctctgttg tcgcgaaggt tgtttcttcc ggcgccgact ctgtcttttt cgccggctat       720
     tacccggaag ctgctgcatt ctttacgcaa ctgaggggtg cgggatttaa tggttatttg       780
     gttgttccgg atggttcact tgatagaaat ctcagtaagc tcgctggaca ggctgccgtg       840
     ggcgtttacg cggtttgccc ttgcaccgat gactcgcagg tcgccggttt tggtgatgca       900
     atgaaaaagg cctacggtca ctatccgggc atatactcct cgagtgcata cgatgttaca       960
     accattctgc taagggggat agactctggg cgcacctctc ggtcatcctt actggactgg      1020
     gtcaggggat atgatgcgta tggggtttct ggtcactaca agtttaaggc aaatggtgat      1080
     ttgcagcaca cccggctgta tttctatagg tttgatgagt caggtgctcc tgtattggtt      1140
     ggagagtaca gtaaataa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page