(data stored in ACNUC30630 zone)

EMBL: BX251410.PE186

BX251410.PE186       Location/Qualifiers
FT   CDS_pept        239174..240178
FT                   /transl_table=11
FT                   /locus_tag="TW201"
FT                   /product="putative ABC transporter branched chain amino
FT                   acid transport permease"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport system permease protein
FT                   LivH or b3457 or z4827 or ecs4304 SWALL:LIVH_ECOLI
FT                   (SWALL:P08340) (308 aa) fasta scores: E(): 1.1e-30, 42.05%
FT                   id in 302 aa"
FT                   /protein_id="CAD66878.1"
FT                   /translation="MLLSLDYLLSQSWITFDVASFIKGFGFATVEGLTFGAIYALIAVG
FT                   YTVVYGVLGLINFAHAGVFVTGCYALVFTLSALGFSSFPSKKPIFIVLIYVLIAVFVSI
FT                   LAAAAVAFLVERVAYKPLRKRNAPNLAFLITAIGASLTISNLFFLRSPNPEPALSIFTP
FT                   VPLFKFFGATVTSFNVVTILAAVILMFLVDWFIRRTRFGRGIRAVAQDPNTASLVGVNP
FT                   ERVIALTFVLGGVIAGAASLFYVLKVPSGVVYNADIVLGLKAFAAAVLGGIGSIRGALL
FT                   GGLLLGLFSNWGALLLGNSQWGDVSVFVLLLLVLLFRPSGILGRSGLSAKSRM"
     ttgttgctta gtttggatta tcttttgagt cagtcgtgga tcacgtttga tgtggcttcc        60
     ttcatcaagg gctttggctt tgctacggtt gaaggcctga ctttcggtgc catctatgca       120
     ctgattgccg ttggctatac cgtggtgtac ggtgttttgg ggcttatcaa tttcgctcat       180
     gctggggttt ttgttaccgg ctgctacgcc cttgtattta cgctctctgc gcttggtttt       240
     agctcttttc cttctaagaa gcccattttt attgttctta tttacgtcct catcgcggtg       300
     tttgtttcca ttcttgctgc tgccgctgtt gcctttcttg ttgagcgcgt tgcctataag       360
     cctcttagga agagaaatgc ccctaatctg gcatttctaa ttactgcaat aggtgcttcc       420
     ctgaccataa gtaatttatt ttttcttcgt tccccaaatc cagagcctgc actttctatt       480
     tttaccccag tccctctttt taaatttttt ggtgcaactg ttacaagctt taatgtggtg       540
     acaattctgg ctgcggtaat cctgatgttt ttggttgact ggttcataag gcggaccaga       600
     tttggcaggg gcattagagc tgtggcgcag gatcctaaca ctgcttcact tgttggagtg       660
     aaccccgagc gggttatagc gctgactttt gttcttggtg gtgttatagc tggcgctgca       720
     agtctgttct atgttctaaa ggttccttcg ggtgttgtgt acaatgcgga tattgttctc       780
     ggtttaaagg cttttgctgc tgccgttctg ggtggcattg gcagcattcg gggcgctcta       840
     ctcggagggc ttctgctcgg tctgttctct aactggggtg ctctgctttt gggtaatagc       900
     cagtggggtg atgtttctgt ctttgttctt ctgttactag ttttactttt caggccatct       960
     ggtatcctcg gcagatctgg cctttcggct aaaagcagga tgtga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page