(data stored in ACNUC30630 zone)

EMBL: BX251410.PE187

BX251410.PE187       Location/Qualifiers
FT   CDS_pept        240175..241269
FT                   /transl_table=11
FT                   /locus_tag="TW202"
FT                   /product="putative ABC transporter branched chain amino
FT                   acid transport permease"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport system permease protein
FT                   LivM or b3456 SWALL:LIVM_ECOLI (SWALL:P22729) (425 aa)
FT                   fasta scores: E(): 2.9e-14, 36.19% id in 326 aa"
FT                   /protein_id="CAD66879.1"
FT                   /translation="MMGFLSSVMRWWKGMSRPQQWFFLLPFVVLVYLLPIINPPVITTE
FT                   PGNNFPISLFTMAIYALAAVGLNVVVGYAGLLDLGYIAFFAVGAYVSAVFTSPDSPYVK
FT                   IPYLWTIPVAIFTAMVFGAALGVPTLRLRGDYLAIVTLGFGEIVRIMATVIPALRGNLG
FT                   FSNVGHPPGDYPSGQPIFTPDNGVAWYWVAITVVIFVLVIVGNLERSIVGRNWFAICQD
FT                   EDAAEVMGVNTFSFKVWAFAIGAAIGGLSGSLQAAQTGFVNNQRFDVATSVLFLVAVVL
FT                   GGSGNKFGAAIGGALVAYIPLRFTEIAQYKYLIFGVCLILLMLFRHEGLFPMKANLFSR
FT                   QVLLRKLSLRHSPDKRASSSPSGS"
     gtgatgggct ttctatcgtc tgttatgcgg tggtggaagg gtatgtctcg cccccagcag        60
     tggttttttc ttcttccgtt tgtggtcctt gtttatcttt tgccaattat taatcctccg       120
     gttatcacaa ccgaaccggg caataatttt ccaatctcac tgtttacaat ggcaatttat       180
     gccctcgccg cggtcggtct taatgtagtt gttggttatg caggacttct tgatttgggt       240
     tatattgcat tttttgcggt tggtgcttat gtatctgctg tatttacgag tccggattct       300
     ccgtatgtca aaattcctta tctttggacc attcctgttg cgatttttac tgccatggtt       360
     tttggcgcag ccctgggtgt acctaccctc cgtcttcggg gagactatct ggcgattgtt       420
     actcttgggt ttggagagat agtcagaatt atggcgactg ttatccctgc cctccgtggt       480
     aacctcgggt tttccaatgt tggccacccg ccgggcgact atccttctgg ccagccgatt       540
     ttcacgcctg ataatggagt agcttggtat tgggtcgcta ttacagttgt tatattcgtt       600
     cttgtaatcg ttgggaatct cgagaggagt attgtcggca gaaactggtt tgctatctgc       660
     caggatgaag atgctgcaga ggttatgggt gtgaatacct tttccttcaa ggtatgggct       720
     tttgcaattg gtgctgcaat tggtggcctc tccggttccc tgcaggctgc acagacaggg       780
     tttgtaaata atcagcgttt tgatgttgcg acctccgttt tattccttgt tgcagtcgta       840
     cttggcggtt ctggtaacaa atttggtgct gcaattggtg gtgcacttgt ggcgtatatt       900
     ccactgcgtt ttacggagat tgcacaatac aagtatttga tcttcggtgt atgtcttata       960
     cttctgatgc tttttagaca tgaaggcctg tttcctatga aggcaaatct tttttcaaga      1020
     caggttttgc tgcggaaatt gtcattgcgc cattcacccg ataaacgtgc gtcatcttcg      1080
     ccctcggggt cttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page